Recombinant Mouse Membrane-spanning 4-domains subfamily A member 4D (Ms4a4d)

What is Mouse Membrane-spanning 4-domains subfamily A member 4D (Ms4a4d)?

Ms4a4d is a transmembrane protein belonging to the membrane-spanning 4-domains subfamily A (MS4A) gene cluster . It is characterized by multiple transmembrane domains that integrate into cellular membranes . The full protein sequence consists of 225 amino acids with several distinct domains responsible for its membrane integration and functional properties . As a member of the MS4A family, it shares structural similarities with other proteins in this cluster that have been implicated in immune modulation and neurological disease processes .

What is the molecular structure and basic characteristics of Ms4a4d?

Ms4a4d is a full-length protein consisting of 225 amino acids with the following sequence: MQGLAQTTMAVVPGGAPPSENSVIKSQMWNKNKEKFLKGEPKVLGAIQVMIAFINFSLGIIILNRVSERFMSVLLLAPFWGSIMFIFSGSLSIAAGVKPTKAMIISSLSVNTISSVLAVAASIGVISVIGVFRQFRSQPAIASLVLMTILNMLEFCIAVSVSAFGCKASCCNSSEVLVVLPSNSAVTVTAPPMILQPLPPSECQGKNVPENLYRNQPGEIV . The protein contains multiple transmembrane domains that anchor it within cellular membranes, typical of the MS4A family architecture . Recombinant Ms4a4d protein is typically produced in cell-free expression systems with ≥85% purity as determined by SDS-PAGE analysis .

How is Ms4a4d related to other members of the MS4A gene family?

Ms4a4d belongs to the MS4A gene cluster that includes multiple family members with similar structural characteristics but potentially diverse functions . Within this family, MS4A4A has been more extensively studied and shows associations with Alzheimer's disease risk through genome-wide association studies . The MS4A gene cluster members share a common architecture of multiple membrane-spanning domains, suggesting possible functional redundancy or specialization within specific cellular contexts . Though less studied than MS4A4A, Ms4a4d likely participates in similar cellular processes involved in immune function and possibly neurological health .

What are the optimal storage and handling conditions for recombinant Ms4a4d?

Recombinant Ms4a4d protein should be stored at -20°C for regular storage needs, with -80°C recommended for extended storage periods . The protein is typically supplied in a Tris-based buffer containing 50% glycerol optimized for stability . Avoid repeated freeze-thaw cycles as they can compromise protein integrity and activity . For ongoing experiments, working aliquots can be maintained at 4°C for up to one week . When handling the protein, consider its transmembrane nature, which may affect solubility and interaction properties in experimental systems .

What expression systems are used for producing recombinant Ms4a4d?

Recombinant Ms4a4d is typically produced using cell-free expression systems that allow for efficient production of complex transmembrane proteins . These systems bypass cellular barriers that can complicate the expression of membrane proteins in traditional cellular systems . The cell-free approach enables production of Ms4a4d with high purity (≥85% as determined by SDS-PAGE) . Researchers should note that the tag type for purification is generally determined during the production process and optimized for the specific protein characteristics of Ms4a4d . When designing experiments requiring recombinant Ms4a4d, consider how the production method and any tags might influence protein function or experimental outcomes .

How is the MS4A gene family implicated in Alzheimer's disease research?

The MS4A gene cluster has emerged as an important factor in Alzheimer's disease (AD) pathophysiology through genome-wide association studies (GWAS) . Specifically, common variants in the MS4A locus have been identified that modify AD risk: rs1582763 (protective) and rs6591561 (risk) . These variants serve as major regulators of CSF sTREM2 levels, a biomarker associated with microglial activity in AD . Research using single nucleus transcriptomics has revealed that these MS4A variants regulate a specific "chemokine" microglial subpopulation . The protective variant increases MS4A4A expression and shifts this microglial subpopulation to an interferon state, while the risk variant suppresses MS4A4A expression and reduces this microglial subpopulation . These findings provide mechanistic explanations for how MS4A variants influence AD risk and suggest potential therapeutic strategies targeting microglia resilience in AD pathogenesis .

What methodologies are used to study Ms4a4d in microglia function?

Advanced research into Ms4a4d function in microglia utilizes cutting-edge methodologies, particularly single-nucleus RNA sequencing (snRNA-seq) . This technique allows researchers to profile brain tissues from carriers of different MS4A variants and identify specific microglial subpopulations affected by these genetic variations . Meta-analysis across multiple brain cohorts (such as Knight ADRC, Mayo, and ROSMAP collections totaling 579 brains) enables identification of differentially expressed genes associated with MS4A variants . Researchers combine genomic and transcriptomic technologies to identify how variants in the MS4A locus regulate specific microglial subpopulations . Additional methodologies may include immunofluorescence to visualize protein expression, functional assays to assess microglial activity, and pathway analysis to understand the broader impact of Ms4a4d on cellular functions .

How does MS4A family expression relate to immune response in neurological conditions?

Research has revealed that MS4A family members play important roles in regulating immune responses relevant to neurological conditions . MS4A4A specifically modulates a unique microglial state characterized by chemokine function . The AD risk variant rs6591561 in MS4A4A promotes inflammasome response and increases intracellular cholesterol storage, suggesting a link between MS4A proteins, lipid metabolism, and inflammatory pathways . Meta-analysis across brain cohorts has identified 1597 differentially expressed genes as a function of the rs6591561 genotype, with enrichment in sorted microglia from human brains (1593/1597 genes) . Genes altered by this variant are involved in pathways associated with elevated pro-inflammatory responses, including NF-kB signaling (p=1.04×10^-6), cytokine-mediated signaling (p=2.75×10^-7), and IFN-γ responses (p=1.78×10^-5) . This suggests that MS4A family members, including potentially Ms4a4d, participate in regulating neuroinflammatory processes relevant to neurodegeneration .

How do researchers analyze GWAS data related to the MS4A gene cluster?

Analysis of GWAS data for the MS4A gene cluster involves sophisticated meta-analytical approaches combining multiple independent datasets . In a Spanish population study, researchers conducted a meta-analysis of five GWASs (Murcia, ADNI, GenADA, NIA, and TGEN) including 3,009 AD cases and 3,006 controls, analyzing 696,707 SNPs common to all datasets . They identified several significant signals, particularly in chromosome 11 which contains the MS4A cluster . Peak association for MS4A was found at rs7626344 (P = 5.48E-6) . Further meta-analysis incorporating data from additional studies by Harold et al. and Hu et al. strengthened these findings, resulting in 17 markers above the GWAS significance level . The most significant SNP in the MS4A cluster was rs1562990 (OR 0.87; P = 3.01E-10) . Researchers typically validate these findings through replication in independent cohorts and functional studies to understand the biological significance of identified variants .

What bioinformatics approaches are used to investigate Ms4a4d gene expression patterns?

To investigate Ms4a4d expression patterns, researchers employ advanced bioinformatics approaches including differential gene expression analysis across various tissues and cell types . Single-nucleus RNA sequencing (snRNA-seq) is particularly valuable for profiling cell-type specific expression in complex tissues like brain . Analysis typically involves quality control of sequencing data, normalization to account for technical variations, and sophisticated statistical methods to identify differentially expressed genes . For MS4A variants, researchers have used meta-analysis across multiple brain cohorts to achieve sufficient statistical power, identifying hundreds of differentially expressed genes (1597 genes with FDR<0.05) . Pathway enrichment analysis then helps categorize these genes into functional groups, revealing biological processes affected by MS4A expression changes . These bioinformatics approaches allow researchers to connect genetic variation to cellular function through gene expression patterns .

How do researchers interpret contradictory data regarding Ms4a4d function?

When confronting contradictory data regarding Ms4a4d function, researchers employ several methodological approaches to resolve discrepancies . First, they examine experimental design differences that might explain conflicting results, including cell types used, expression levels, and experimental conditions . Second, they consider genetic background variations in mouse models or cell lines that might influence Ms4a4d function . Third, researchers evaluate the technical approaches used, as different methodologies (protein interaction studies vs. genetic knockdown/overexpression) may reveal different aspects of protein function . Meta-analysis across multiple studies helps identify consistent patterns despite methodological variations . Additionally, single-cell technologies provide resolution to determine if apparently contradictory functions occur in different cell subpopulations or states . For MS4A family members, differences in function may reflect their roles in specific microglial subpopulations that respond differently to various stimuli or disease states .

What mouse models are appropriate for studying Ms4a4d function?

When selecting mouse models for studying Ms4a4d function, researchers should consider several factors based on their specific research questions . For basic characterization, wild-type models expressing endogenous Ms4a4d provide baselines for expression patterns across tissues and developmental stages . For mechanistic studies, genetic approaches including conventional knockout mice, conditional knockouts (using Cre-lox systems with microglial or immune cell-specific promoters), or knock-in models introducing specific mutations can be valuable . Given the MS4A family's implications in Alzheimer's disease, researchers might utilize established AD mouse models (such as APP/PS1 or 5xFAD) crossed with Ms4a4d-modified lines to study its role in disease pathogenesis . For studying human variants, humanized mouse models carrying specific human MS4A alleles associated with AD risk may provide insights into how these variants affect microglia function and disease progression .

How can findings from Ms4a4d research be translated to human MS4A biology?

Translating findings from mouse Ms4a4d research to human MS4A biology requires careful consideration of similarities and differences between species . Comparative genomic analysis can identify conserved regions and functions between mouse Ms4a4d and human MS4A family members . Researchers should examine expression patterns across species, determining whether mouse Ms4a4d and human MS4A proteins share similar tissue distribution and cellular localization . Functional assays can test whether mouse and human proteins participate in comparable pathways or cellular processes . In the context of Alzheimer's disease research, human brain samples carrying different MS4A variants can be compared with mouse models to validate findings . Single-nucleus RNA sequencing of both human and mouse tissues allows comparison of the microglial subpopulations regulated by MS4A proteins across species . These approaches help determine which aspects of Ms4a4d biology in mice are likely relevant to human health and disease .

What are the potential therapeutic implications of targeting MS4A family proteins?

The MS4A gene family presents promising therapeutic targets, particularly for Alzheimer's disease, based on their role in regulating microglial function and neuroinflammation . GWAS studies have identified MS4A variants that modify AD risk: the protective variant increases MS4A4A expression while the risk variant suppresses it, suggesting that enhancing MS4A4A function might be therapeutically beneficial . MS4A proteins regulate a "chemokine" microglial subpopulation that can shift to an interferon state associated with protection against AD . Potential therapeutic approaches might include: (1) small molecules or biologics that enhance MS4A protein expression or function, mimicking the protective variant's effects; (2) targeted approaches to modulate the specific microglial subpopulation regulated by MS4A proteins; (3) interventions addressing the downstream pathways affected by MS4A variants, such as inflammasome activation or cholesterol metabolism . Development of such therapies requires further research to understand the precise mechanisms by which MS4A family members, including potentially Ms4a4d, regulate microglial states and neuroinflammation .