Recombinant Mouse Membrane-spanning 4-domains subfamily A member 6B (Ms4a6b)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Characteristics

Membrane-spanning 4-domains subfamily A member 6B (Ms4a6b) is a distinctive member of the MS4A protein family, characterized by its four transmembrane domains that create a channel-like structure within the cell membrane. The full-length mouse Ms4a6b protein consists of 244 amino acids and shares structural similarities with other MS4A family members . These proteins are structurally related to CD20, a B-cell surface molecule, and are thought to function primarily as components of multimeric receptor complexes involved in signal transduction pathways .

Ms4a6b belongs to a family of transmembrane chemosensors, with emerging evidence suggesting their role in regulating immune cell function . The transmembrane domains create a configuration that likely facilitates the protein's participation in cellular signaling cascades, potentially involving ion transport or receptor-mediated activities. Given its expression in microglia, Ms4a6b may participate in immune-related signaling processes specific to the central nervous system.

Expression Patterns

Ms4a6b exhibits highly specific expression patterns that suggest specialized functions in particular cell types and developmental stages. Research has demonstrated that Ms4a6b is prominently expressed in microglial cells, the resident immune cells of the central nervous system . Its expression appears to be temporally regulated during development, with significant expression observed particularly at embryonic day 14.5 (E14.5) in mouse development .

The expression of Ms4a6b shows dynamic regulation throughout development. During early embryonic stages, a distinct subset of microglia exhibit high expression of Ms4a6b along with other MS4A family members, including Ms4a7, Ms4a6c, and Ms4a6d . This expression pattern suggests these cells may have specialized roles during critical periods of brain development. Notably, approximately 10% of all E14.5 microglia express high levels of MS4A family proteins, while no more than 3% of microglia at other developmental stages show similar expression patterns .

Role in Cellular Signaling

Ms4a6b is believed to function primarily in signal transduction as a component of multimeric receptor complexes . Though the specific signaling pathways involving Ms4a6b remain incompletely characterized, the protein's structural features and expression patterns provide valuable insights into its potential functions.

As a member of the MS4A family, Ms4a6b likely shares functional similarities with better-characterized family members. Some MS4A proteins have been implicated in calcium signaling pathways, which are crucial for numerous cellular processes including immune cell activation, migration, and phagocytosis. Given its predominant expression in microglia, Ms4a6b may participate in signaling cascades that regulate microglial functions during brain development and in response to pathological conditions. The temporally regulated expression of Ms4a6b during embryonic development further suggests its involvement in developmental processes that require precise timing of microglial activation or differentiation.

Expression in Embryonic Development

One of the most significant findings regarding Ms4a6b is its expression in a specific subpopulation of microglia during embryonic brain development. Research has identified that MS4A family members, including Ms4a6b, are expressed in a distinct cluster of microglia at embryonic day 14.5 (E14.5) in mouse development . This temporal specificity suggests that Ms4a6b-expressing microglia may perform specialized functions during this critical period of brain development.

The highly regulated temporal expression pattern is particularly noteworthy, with approximately 10% of all E14.5 microglia expressing high levels of MS4A family members, while no more than 3% of microglia at other developmental stages fall into this category . This distinct temporal regulation suggests that Ms4a6b may contribute to specific developmental processes occurring during this embryonic period, potentially including neuronal circuit formation, synaptic pruning, or other aspects of neural development.

Relation to Brain Border Macrophages

Intriguingly, the subpopulation of microglia that express Ms4a6b and other MS4A family members (particularly Ms4a7) share a similar transcriptional profile with brain border macrophages . Brain border macrophages, which reside in the perivascular space, meninges, and choroid plexus, derive from the same pool of yolk sac hematopoietic progenitors as microglia and migrate to the brain during the same developmental period .

This subpopulation of Ms4a-expressing microglia has been found to express increased transcripts of both macrophage markers (Mrc1, Ccr1, Dab2) and mature microglial markers (P2ry12, Fcrls, Serpine2), suggesting they exist in an intermediate state between these cell types . This finding raises important questions about the developmental relationship between these cells and their potential role as either precursors to mature microglia or as a specialized microglial subtype with unique functions during development.

MS4A Family Protein Interactions

Ms4a6b demonstrates significant interactions with several other proteins, particularly other members of the MS4A family. According to protein interaction data, Ms4a6b has strong predicted functional partnerships with multiple related proteins, as shown in Table 1 .

Table 1: Top Protein Interactions with Ms4a6b

Protein PartnerInteraction ScoreProtein Description
Ms4a4b0.788Membrane-spanning 4-domains, subfamily A, member 4B
Ms4a4c0.735Membrane-spanning 4-domains, subfamily A, member 4C
Gm83690.701Predicted gene 8369
Ms4a6c0.685Membrane-spanning 4-domains subfamily A member 6C
Ms4a100.544Membrane-spanning 4-domains subfamily A member 10

These interactions suggest that Ms4a6b may function as part of a larger complex of MS4A family proteins . The high interaction scores with other MS4A members indicate potential functional cooperation, perhaps in forming multimeric receptor complexes or in coordinating signaling responses in microglia and other immune cells.

Association with Signaling Pathways

Beyond its interactions with other MS4A family members, Ms4a6b shows associations with several important signaling molecules that provide further insights into its potential functions. Notable interactions include Epha1 (Ephrin type-A receptor 1, interaction score: 0.538), a receptor tyrosine kinase involved in contact-dependent bidirectional signaling between adjacent cells, and Cd33 (Myeloid cell surface antigen CD33, interaction score: 0.510), a sialic-acid-binding immunoglobulin-like lectin that plays a role in mediating cell-cell interactions and maintaining immune cells in a resting state .

These interactions suggest that Ms4a6b may participate in signaling pathways related to cell-cell communication, particularly in the context of immune cell function. The association with Epha1 is especially intriguing given that Ephrin signaling is involved in various developmental processes, potentially linking Ms4a6b to specific developmental functions in the brain. Similarly, the interaction with Cd33, which is involved in regulating immune cell activation states, aligns with the potential role of Ms4a6b in microglial function during development and in response to pathological conditions.

Connection to Alzheimer's Disease Mechanisms

While direct evidence specifically linking Ms4a6b to Alzheimer's disease (AD) is limited in the provided search results, the broader MS4A gene family has been implicated in AD pathogenesis. Research has shown that the MS4A gene cluster is a key modulator of soluble TREM2 (Triggering Receptor Expressed on Myeloid cells 2), which has been associated with Alzheimer's disease .

TREM2 plays a critical role in microglial activation, survival, and phagocytosis, all of which are processes relevant to AD pathology. Given that Ms4a6b is expressed in microglia and belongs to the MS4A family, it may share some functional relationships with other MS4A members that have been more directly linked to AD, such as MS4A4A . The MS4A locus has been identified in genome-wide association studies (GWAS) as a risk factor for late-onset Alzheimer's disease, with common variants in this gene cluster modifying AD risk through modulation of extracellular soluble TREM2 .

Of particular interest is the finding that variants in the MS4A locus, specifically rs1582763 (an intergenic variant near MS4A4A) and rs6591561 (a missense variant within MS4A4A), are associated with altered levels of soluble TREM2 in cerebrospinal fluid . While these studies have focused primarily on MS4A4A rather than MS4A6B specifically, the functional similarities between family members and their co-expression patterns suggest potential roles for Ms4a6b in similar biological pathways relevant to AD pathogenesis.

Implications for Other Neurological Disorders

Beyond Alzheimer's disease, the expression of Ms4a6b in microglia suggests potential implications for other neurological disorders where microglial function plays a significant role. Microglia are critical for brain development, homeostasis, and response to injury or disease. Dysregulation of microglial function has been implicated in various neurological conditions, including neurodevelopmental disorders, neurodegenerative diseases, and neuroinflammatory conditions.

The temporal regulation of Ms4a6b expression during embryonic development suggests it may have specific roles during this critical period. Disruptions to these developmental processes could potentially contribute to neurodevelopmental disorders. Additionally, the upregulation of some MS4A family members in microglia from injured tissue indicates potential roles in the response to pathological conditions, suggesting that Ms4a6b might be involved in neuroinflammatory responses relevant to various neurological disorders.

Expression Systems and Purification Methods

Recombinant mouse Ms4a6b protein has been successfully produced using cell-free protein synthesis (CFPS) systems . This approach offers significant advantages for the production of membrane proteins like Ms4a6b, which can be challenging to express in traditional cell-based systems due to their hydrophobic transmembrane domains and potential toxicity to host cells.

The recombinant Ms4a6b protein, encompassing amino acids 1-244 (the full-length protein), has been produced with a Strep Tag for purification and detection purposes . Purification is typically accomplished through one-step affinity chromatography, leveraging the Strep Tag to isolate the protein of interest from the expression system components. The ALiCE® cell-free expression system, based on a lysate obtained from Nicotiana tabacum, has been used successfully for Ms4a6b production, providing all the necessary protein expression machinery .

This production method can generate functional proteins, as noted by the commercial provider, though individual protein activity may vary and specific testing is required to confirm functionality in particular applications . The ability to produce recombinant Ms4a6b opens up numerous research applications for studying this protein's structure, function, and interactions.

Research Applications

Recombinant Ms4a6b protein has several valuable applications in research settings, as summarized in Table 2.

Table 2: Research Applications of Recombinant Ms4a6b

Application CategorySpecific ApplicationsRelevance
Biochemical AnalysisSDS-PAGE, Western Blotting, ELISA Detection and quantification of Ms4a6b
Structural StudiesX-ray crystallography, Cryo-EMDetermination of three-dimensional structure
Interaction StudiesPull-down assays, Co-immunoprecipitationIdentification of binding partners
Functional AssaysSignaling pathway analysisInvestigation of role in cellular signaling
Antibody DevelopmentImmunization, Antibody validationGeneration of research and diagnostic tools

The commercially available recombinant Ms4a6b is specifically cited as suitable for applications including SDS-PAGE, Western Blotting, and ELISA , making it valuable for a range of biochemical and immunological techniques essential for characterizing this protein. These applications facilitate research into Ms4a6b's expression patterns, interactions with other proteins, and potential roles in normal development and pathological conditions.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Ms4a6b; Membrane-spanning 4-domains subfamily A member 6B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-244
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Ms4a6b
Target Protein Sequence
MIPQVVTSETVAMISPNGMSLPQTDKPQPFHQWQDSLKKHLKAEIKVMAAIQIMCAVMVL SLGIILASVPSNLHFTSVFSVLLKSGYPFIGALFFIVSGILSIVTETKSTKILVDSSLTL NILSVSFAFMGIIIISVSLAGLHPASEQCLQSKELRPTEYHYYQFLDRNECFAAKSVLAG VFSLMLISTMLELGLAVLTAMLWWKQSHSNIPGNVMFLPHSSNNDSNMESKVLCNPSYEE QLVC
Uniprot No.

Target Background

Function

May be involved in signal transduction as a component of a multimeric receptor complex.

Database Links
Protein Families
MS4A family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed at high levels in thymus, spleen, and peripheral lymph nodes, with less abundant levels in non-lymphoid tissues.

Q&A

What is Ms4a6b and what protein family does it belong to?

Ms4a6b is a member of the membrane-spanning 4-domains subfamily A (MS4A) gene family that shares a CD20 domain structure. It is a 244 amino acid transmembrane protein primarily expressed in mice that functions as a component of multimeric receptor complexes involved in signal transduction pathways . The MS4A family consists of several related proteins including MS4A4B, MS4A4C, MS4A6C, and MS4A10, with which Ms4a6b shows significant functional interactions and sequence homology .

What is the genomic location and structure of the MS4A gene cluster?

The MS4A gene family is located in a 492-Kb region on chromosome 11q12 in humans (with mouse homologs on the corresponding syntenic region). This gene cluster contains 11 members of the MS4A gene family that share the CD20 domain . The genes in this cluster are arranged in close proximity, suggesting possible coordinated regulation and functional relationships. Comprehensive mutation analysis studies have cataloged rare variants within this locus with potential implications for neurological disease risk or protective effects .

What are the known interaction partners of Ms4a6b?

Ms4a6b interacts with several proteins based on STRING database analysis, with the strongest predicted functional partners including:

Interaction PartnerFunctionInteraction Score
Ms4a4bMembrane-spanning 4-domains, subfamily A, member 4B0.788
Ms4a4cMembrane-spanning 4-domains, subfamily A, member 4C0.735
Gm8369Predicted gene 83690.701
Ms4a6cMembrane-spanning 4-domains subfamily A member 6C0.685
Ms4a10Membrane-spanning 4-domains subfamily A member 100.544
Epha1Ephrin type-A receptor 10.538
Cd33Myeloid cell surface antigen CD330.510

These interactions suggest Ms4a6b may function within a network of immune-related signaling proteins, particularly in myeloid cells including microglia .

In which cell types and tissues is Ms4a6b predominantly expressed?

Ms4a6b is predominantly expressed in myeloid cells, with particularly notable expression in microglial cells in the brain. Single-cell RNA sequencing studies have demonstrated that Ms4a6b expression varies across different microglial activation states in response to aging and disease conditions . Expression has been detected in both cortical and hippocampal microglia, with expression levels changing in response to progressive amyloid-β accumulation and aging . Ms4a6b is also expressed in other tissue-resident macrophages and immune cells, though its expression profile can vary significantly depending on activation state.

How does Ms4a6b expression change during microglial activation in neurodegenerative conditions?

Expression of Ms4a6b undergoes significant changes during microglial activation in response to amyloid-β deposition and aging. Studies in App mice (a model of Alzheimer's disease) have identified six major subpopulations of microglia with different abundances between genotypes and age groups . Ms4a6b expression patterns contribute to defining activated response microglia (ARMs) states, with expression levels changing as microglia progress through different activation trajectories. Notably, microglia from female mice progress faster in this activation trajectory than males, despite the response types and genes involved being conserved between sexes .

How can researchers detect and quantify Ms4a6b protein levels in experimental samples?

For accurate detection and quantification of Ms4a6b protein levels, researchers can employ several methodological approaches:

  • ELISA assays: Commercial ELISA kits are available for detection of mouse Ms4a6b in tissue homogenates, cell lysates, and biological fluids. These kits typically offer a detection range of 0.156-10 ng/ml using colorimetric detection methods .

  • Western blotting: Using specific antibodies against Ms4a6b for protein detection in cell and tissue lysates.

  • Immunohistochemistry/Immunofluorescence: For localization studies in tissue sections.

  • Flow cytometry: For quantifying Ms4a6b expression in single cells from dissociated tissues.

When using these methods, researchers should be aware that detection of native Ms4a6b is generally more reliable than detection of recombinant proteins, which may have different sequences or tertiary structures .

What is the proposed signaling function of Ms4a6b in microglia?

Ms4a6b is proposed to function as a component of multimeric receptor complexes involved in signal transduction pathways in microglia . While the precise signaling mechanisms remain under investigation, evidence suggests that Ms4a6b and related MS4A family members may regulate microglial activation states that are relevant to neurodegenerative diseases. The protein likely participates in receptor complexes that influence microglial phenotype switching between homeostatic states and various activated states, including ARMs (activated response microglia) and IRMs (interferon response microglia) .

How is Ms4a6b related to TREM2 signaling in microglia?

While the search results don't specifically mention direct interactions between Ms4a6b and TREM2, they indicate that MS4A family members (particularly MS4A4A) regulate soluble TREM2 (sTREM2) levels and may modify TREM2 biology . This relationship is significant because TREM2 is a critical receptor for microglial function and a key risk gene for Alzheimer's disease. Research has shown that genetic variants in the MS4A gene region are major regulators of sTREM2, suggesting that MS4A proteins like Ms4a6b may be involved in modulating TREM2-dependent signaling pathways in microglia that affect their fitness and response to pathology .

What are the recommended approaches for studying Ms4a6b gene expression in single-cell experiments?

For studying Ms4a6b gene expression at the single-cell level, researchers should consider the following methodological approaches:

  • Single-cell RNA sequencing (scRNA-seq): This has been successfully employed to characterize Ms4a6b expression across different microglial subpopulations. Studies have analyzed cortical and hippocampal microglia in female and male mice at different age points (3, 6, 12, and 21 months) to track expression changes over time .

  • Clustering analysis: Computational approaches for identifying major subpopulations of microglia based on gene expression profiles, including Ms4a6b expression patterns .

  • Differential expression analysis: To identify tissue-specific or sex-specific responses in Ms4a6b expression under various experimental conditions .

  • Trajectory analysis: To track the progression of microglial states over time and in response to pathological conditions, with Ms4a6b expression serving as a marker for specific activation states .

These approaches allow researchers to characterize the heterogeneity of Ms4a6b expression across different microglial populations and under different experimental conditions.

What controls should be included when performing Ms4a6b protein detection assays?

When performing Ms4a6b protein detection assays, researchers should include the following controls:

  • Positive controls: Samples known to express Ms4a6b (e.g., activated microglial cells or macrophages)

  • Negative controls:

    • Samples from tissues not expected to express Ms4a6b

    • For antibody-based methods: isotype controls or secondary antibody-only controls

    • For ELISA: blank wells and standard curve controls

  • Validation controls:

    • Ms4a6b knockout or knockdown samples when available

    • Recombinant Ms4a6b protein as a standard (noting the limitations as mentioned in product documentation )

  • Experimental condition controls:

    • Age-matched controls when studying age-dependent effects

    • Sex-matched controls to account for sex differences in Ms4a6b expression

    • Both cortical and hippocampal samples when studying brain expression patterns

Researchers should also consider the stability of reagents and standardize operation procedures to minimize performance fluctuations in assays such as ELISA .

How does Ms4a6b expression change in Alzheimer's disease models?

In Alzheimer's disease mouse models such as the App NL-G-F mice, Ms4a6b expression changes significantly with disease progression. Gene expression profiling of microglial cells has revealed that:

  • Progressive amyloid-β accumulation accelerates two main activated microglia states that are also present during normal aging .

  • These activated states include:

    • Activated response microglia (ARMs), which overexpress MHC type II and putative tissue repair genes like Dkk2, Gpnmb, and Spp1

    • Interferon response microglia (IRMs), which have a distinct gene expression profile

  • ARMs are strongly enriched with Alzheimer's disease risk genes, suggesting a potential role for Ms4a6b in disease pathogenesis .

  • The response trajectory of microglia shows sex differences, with female mice progressing faster in the activation trajectory compared to males .

This dynamic expression pattern indicates that Ms4a6b likely plays a role in the microglial response to amyloid pathology and may be involved in disease progression mechanisms.

What genetic evidence links the MS4A gene cluster to Alzheimer's disease risk?

Several lines of genetic evidence link the MS4A gene cluster, including Ms4a6b, to Alzheimer's disease risk:

  • Genetic variants in the MS4A gene region were identified as being associated with AD risk around 2011 .

  • Comprehensive mutation analysis has catalogued rare variants with potential risk or protective effects in the MS4A gene clusters .

  • A study found that potentially damaging missense and loss-of-function variants in MS4A genes were twice as frequent in controls (8.2%) than cases (4.3%), suggesting possible protective effects, though this association was only nominally significant (p = 0.047; after Yates' correction p = 0.07) .

  • Specific genetic variants in the MS4A gene region have been identified as major regulators of soluble TREM2 (sTREM2) levels, providing a biological context to the original MS4A-AD genetic association signal .

  • MS4A4A variants have been shown to modify risk for AD by affecting TREM2 biology and microglia fitness, with protective variants associated with expansion of an anti-inflammatory subtype of microglia that expressed interferon and lipid metabolism genes .

This genetic evidence suggests that MS4A family members like Ms4a6b may influence AD risk through effects on microglial function and response to pathology.

How can researchers utilize Ms4a6b as a marker for specific microglial states?

Researchers can utilize Ms4a6b as a marker for specific microglial states through the following methodological approaches:

  • Single-cell transcriptomics: Ms4a6b expression patterns can help identify and characterize specific microglial activation states, particularly in the context of neurodegenerative diseases. Researchers can use Ms4a6b expression alongside other markers to define ARMs (activated response microglia) and distinguish them from other microglial states .

  • Spatial transcriptomics: Combining Ms4a6b expression analysis with spatial information can help researchers understand how different microglial states are distributed within brain regions in relation to pathological features like amyloid plaques.

  • Flow cytometry: Using antibodies against Ms4a6b in combination with other microglial markers can enable prospective isolation of specific microglial subpopulations for further functional studies.

  • Lineage tracing: Combining Ms4a6b expression analysis with fate mapping approaches can help track the dynamics of microglial state transitions over time and in response to disease.

  • In vitro modeling: Monitoring Ms4a6b expression in cultured microglia under different stimulation conditions can help model microglial state transitions and screen for compounds that modulate these transitions.

By utilizing Ms4a6b as a marker in these approaches, researchers can gain insights into microglial heterogeneity and the role of specific microglial states in health and disease.

What are the current challenges in studying the functional role of Ms4a6b in neuroinflammation?

Several challenges exist in studying the functional role of Ms4a6b in neuroinflammation:

  • Redundancy within the MS4A family: The MS4A gene family contains multiple members with potentially overlapping functions, making it difficult to determine the specific contribution of Ms4a6b to observed phenotypes .

  • Context-dependent expression and function: Ms4a6b expression and function may vary significantly depending on the microglial activation state, brain region, sex, and age, requiring careful experimental design to account for these variables .

  • Limited understanding of signaling mechanisms: While Ms4a6b is believed to function in signal transduction as part of multimeric receptor complexes, the specific signaling pathways and downstream effectors remain poorly characterized .

  • Technical challenges in protein detection: The membrane-spanning nature of Ms4a6b can present challenges for antibody-based detection methods, and recombinant proteins may not accurately represent the native protein structure .

  • Translating findings between mouse models and human disease: While mouse models provide valuable insights, differences between mouse Ms4a6b and human MS4A family members must be considered when translating findings to human disease contexts.

  • Dynamic nature of microglial states: The transient and dynamic nature of microglial activation states makes it challenging to establish causal relationships between Ms4a6b expression and functional outcomes in vivo.

Addressing these challenges requires integrated approaches combining genetic manipulation, in vivo imaging, single-cell analysis, and functional assays to elucidate the specific role of Ms4a6b in neuroinflammatory processes.

How might targeting Ms4a6b therapeutically affect microglial function in neurodegenerative diseases?

Targeting Ms4a6b therapeutically could potentially modulate microglial function in neurodegenerative diseases through several mechanisms:

  • Modulation of microglial activation states: Evidence suggests that MS4A family members like Ms4a6b may regulate transitions between different microglial activation states, including a shift from inflammatory chemokine-based profiles toward interferon-based responses . Therapeutic targeting could potentially push microglia toward more beneficial states in disease contexts.

  • Regulation of TREM2 signaling: MS4A family members have been shown to regulate soluble TREM2 (sTREM2) levels . Given the important role of TREM2 in microglial function and neurodegenerative disease risk, modulating Ms4a6b could potentially affect TREM2-dependent processes in microglia.

  • Sex-specific therapeutic approaches: The observation that microglia in female mice progress faster in the deployment of the ARMs response compared to males suggests potential sex differences in Ms4a6b function . This could inform the development of sex-specific therapeutic strategies.

  • Age-dependent interventions: Since microglial activation states change with aging, and Ms4a6b is involved in these transitions, age-specific targeting strategies might be necessary for optimal therapeutic effects .

  • Combination therapies: Targeting Ms4a6b alongside other regulators of microglial function could potentially produce synergistic effects in modulating neuroinflammation in neurodegenerative diseases.

The development of such therapeutic approaches would require further research to elucidate the precise mechanisms by which Ms4a6b affects microglial function in health and disease, as well as the potential consequences of modulating its activity in different disease contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.