Recombinant Mouse Membrane-spanning 4-domains subfamily A member 8A (Ms4a8a)

Shipped with Ice Packs
In Stock

Description

Molecular and Functional Characteristics

Key functions:

  • Acts as a differentiation marker in intestinal epithelial cells, with expression increasing along the crypt–luminal axis .

  • Modulates transcriptomic profiles in colonic cells, particularly upregulating cytoskeletal organization genes (e.g., Krt20) and enhancing resistance to oxidative stress .

  • Reduces proliferation and migration in transfected colon carcinoma cells while increasing apoptosis resistance .

Tissue Distribution

Tissue/ConditionExpression LevelNotes
Healthy murine colonHighLocalized to differentiated epithelium, absent in crypt stem cells .
Human colon carcinomaAbsent/LowLost during neoplastic transformation .
MacrophagesContext-dependentExpressed in alternatively activated (M2) macrophages during parasitic infections or tumor microenvironments .

Regulation

  • Expression correlates with transcription factors CDX2 and HNF1α in intestinal differentiation .

  • No direct association with HNF4α-binding sites in promoter analysis .

Effects in CT26 Colon Carcinoma Cells

ParameterMS4A8A+ Clones vs. ControlsSignificance (p-value)
Scratch assay migration12 h vs. 10 h closure<0.05
BrdU proliferation rate45.8–47% vs. 61.5–63.1%<0.01
H₂O₂-induced apoptosis38–39% vs. 65–77%<0.001

Mechanistic insights:

  • Overexpression upregulates 225 genes, including Krt20 (cytokeratin 20), which strengthens epithelial barrier function .

  • Enhances resistance to reactive oxygen species (ROS), critical for maintaining intestinal homeostasis .

Recombinant Protein Utility

  • Gene silencing: siRNA/shRNA lentivectors (e.g., ABM Cat. No. 30718094) enable functional studies, with guaranteed >70% knockdown efficiency .

  • Therapeutic potential: Loss in human colon adenocarcinomas suggests diagnostic utility for distinguishing malignant vs. healthy tissue .

Technical Considerations

  • Antibodies: Rabbit polyclonal antibodies against murine MS4A8A and human MS4A8B validate expression in immunohistochemistry and Western blot .

  • Lentiviral systems: Third-generation vectors allow stable transfection in dividing and non-dividing cells .

Unresolved Questions and Future Directions

  • Mechanistic pathways: Whether MS4A8A directly confers apoptosis resistance or acts via Krt20 remains unclear .

  • Clinical relevance: Human MS4A8B’s role in colorectal cancer progression warrants further validation in patient cohorts .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for customers.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Ms4a8; Cd20l5; Ms4a8a; Membrane-spanning 4-domains subfamily A member 8; CD20 antigen-like 5; Membrane-spanning 4-domains subfamily A member 8A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-268
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Ms4a8
Target Protein Sequence
MEPEQERLTWQPGTVSMNTVTSPGPMANSVYVVAPPNSYPVVPGTVPQMPIYPSNQPQVH VISGHLPGLVPAMTEPPAQRVLKKGQVLGAIQILIGLVHIGLGSIMITNLFSHYTPVSLY GGFPFWGGIWFIISGSLSVAAETQPNSPCLLNGSVGLNIFSAICSAVGIMLFITDISISS GYIYPSYYPYQENLGVRTGVAISSVLLIFCLLELSIASVSSHFGCQVACCHYNNPGVVIP NVYAANPVVIPEPPNPIPSYSEVVQDSR
Uniprot No.

Target Background

Function
May be involved in signal transduction as a component of a multimeric receptor complex.
Gene References Into Functions
  1. MS4A8A is a novel differentiation marker of the intestinal epithelium. It supports the maintenance of physiological barrier function in the gut by modulating the transcriptome and conferring increased resistance to reactive oxygen species. PMID: 23348583
Database Links
Protein Families
MS4A family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed strongly in intestine and colon and minimally in lung and ovary.

Q&A

What is Ms4a8a and how is it classified among protein families?

Ms4a8a is a member of the Membrane-spanning 4-domains subfamily A (MS4A) protein superfamily. This family consists of tetraspanin proteins characterized by four-transmembrane structures spanning cell membranes. In humans, eighteen MS4A members have been identified, while mice possess twenty-three different molecules . Ms4a8a specifically is a CD20 homolog with important roles in cellular differentiation and immune function .

The MS4A gene family in humans is located on chromosome 11q12, while in mice they are found on chromosome 19. The protein structures feature four transmembrane domains with two extracellular loops, where the second extracellular loop varies in length from 10-46 amino acids and contains conserved sequences such as GYPFWG and FIISGSLS . These proteins function primarily as ion channels regulating calcium flow across cell membranes, though some also serve as molecular chaperones interacting with immune receptors.

Where is Ms4a8a predominantly expressed in normal tissue?

Ms4a8a shows a tissue-specific expression pattern predominantly in differentiated intestinal epithelium in mice. The human homolog (MS4A8B) similarly shows expression in differentiated intestinal epithelium . This expression pattern suggests a role in normal intestinal physiology and differentiation processes.

Interestingly, Ms4a8a is also expressed by specific immune cell populations, particularly tumor-associated macrophages and macrophages involved in certain infectious pathologies . The expression in these cell types points to its involvement in immune regulation and response to pathological conditions.

What is known about the relationship between Ms4a8a and macrophage polarization?

Ms4a8a has been identified as a marker for alternatively activated macrophages (M2 phenotype). Research has shown that in bone marrow-derived macrophages (BMDMs), Ms4a8a expression is strongly induced by a combination of M2 mediators (glucocorticoids/IL-4) and TLR2/4/7 agonists . These Ms4a8a+ BMDMs are characterized by increased expression of M2 markers including mannose receptor (Mmr), arginase 1, and CD163, alongside decreased iNOS expression, confirming their M2-like polarization state .

The induction of Ms4a8a by both M2 mediators and TLR agonists involves the classical TLR signaling cascade via activation of MyD88/TRIF and NF-κB, suggesting Ms4a8a plays a role in integrating pro- and anti-inflammatory signals . This dual responsiveness to both M2 polarization signals and pathogen recognition receptor activation positions Ms4a8a as a potential regulatory molecule at the interface of innate immunity and tissue homeostasis.

How does Ms4a8a influence tumor growth and progression?

Ms4a8a has demonstrated complex and seemingly contradictory roles in tumor biology depending on the cell type expressing it. Research has identified Ms4a8a as a molecule expressed by tumor-associated macrophages that directly enhances tumor growth . This suggests an immunomodulatory function that may contribute to the tumor-promoting activities of M2-polarized macrophages in the tumor microenvironment.

These seemingly contradictory findings highlight the context-dependent nature of Ms4a8a function and underscore the need for careful consideration of cell type and microenvironmental factors when studying its role in cancer.

What are the implications of Ms4a8a in infectious disease models?

Ms4a8a expression has been observed in specific infectious disease contexts, particularly in M2-associated infectious pathologies. In late-stage Trypanosoma congolense infections, Ms4a8a expression was detected in hepatic macrophages, while in Taenia crassiceps infections, it was found in peritoneal macrophages . These findings suggest that Ms4a8a may be part of the host response to chronic parasitic infections.

The expression of Ms4a8a in these contexts appears to be regulated by both pathogen recognition signals (via TLR activation) and the immunomodulatory cytokine environment. Specifically, TLR2/4/7 agonists strongly induced Ms4a8a expression in bone marrow-derived macrophages that were treated with M2 mediators (glucocorticoids/IL-4) . This suggests that Ms4a8a+ macrophages represent a specialized M2-like subset that emerges during the resolution phase of infection or during chronic infections where parasite persistence requires immunomodulation.

Functionally, peritoneal macrophages from late-stage Taenia crassiceps infection showed upregulation of genes like Hdc, Tcfec, and Sla, which were also observed in LPS/dexamethasone/IL-4-stimulated Ms4a8a+ BMDMs . This indicates that Ms4a8a may be involved in modulating specific transcriptional programs during chronic infections, potentially contributing to parasite persistence or tissue repair processes.

How does forced overexpression of Ms4a8a affect cellular functions?

Experimental overexpression of Ms4a8a has revealed several important effects on cellular functions. In the murine colon carcinoma cell line CT26, forced Ms4a8a overexpression resulted in:

  • Reduced cellular proliferation rates

  • Decreased migration capability

  • Increased resistance to hydrogen peroxide-induced apoptosis

  • Altered gene expression profiles, with 225 significantly regulated genes

In RAW264.7 macrophage cells, forced overexpression of Ms4a8a modulated the TLR4 response, altering the expression of various genes including Hdc, Tcfec, and Sla . This demonstrates that Ms4a8a can influence cellular signaling pathways, particularly those downstream of pattern recognition receptors.

The effects of Ms4a8a overexpression on transcriptional programs suggest it functions as more than just an ion channel or cell surface marker, potentially serving as a signaling molecule that integrates various cellular pathways related to differentiation, immune response, and cell survival.

What genes are regulated by Ms4a8a expression?

Gene profiling of Ms4a8a-expressing cells has revealed significant regulation of numerous genes involved in key cellular processes. In Ms4a8a+ CT26 cells, 225 genes were significantly regulated, with major functional categories including:

  • Cytoskeletal organization

  • Apoptosis regulation

  • Proliferation control

  • Transcriptional regulation

  • Metabolic processes

Notably, the highest upregulated gene in Ms4a8a-expressing CT26 cells was cytokeratin 20, an intestinal differentiation marker . This finding supports the role of Ms4a8a as a differentiation marker and suggests it may actively promote differentiation processes in intestinal epithelial cells.

In macrophages, Ms4a8a expression was associated with upregulation of Hdc, Tcfec, and Sla, genes that were confirmed both in primary LPS/dexamethasone/IL-4-stimulated Ms4a8a+ BMDMs and in peritoneal macrophages from late-stage Taenia crassiceps infection . These genes are involved in histamine production, transcriptional regulation, and immune cell signaling, suggesting Ms4a8a influences immunomodulatory functions in macrophages.

What experimental systems are suitable for studying Ms4a8a function?

Several experimental systems have proven valuable for investigating Ms4a8a function:

  • Cell line models:

    • Murine colon carcinoma cell line CT26 with forced Ms4a8a overexpression has been used to study effects on proliferation, migration, and apoptosis resistance

    • RAW264.7 macrophage cells with Ms4a8a overexpression have been utilized to examine effects on TLR4 responses

  • Primary cell cultures:

    • Bone marrow-derived macrophages (BMDMs) treated with M2 mediators (glucocorticoids/IL-4) and TLR agonists provide a system to study Ms4a8a induction and function in macrophage polarization

  • Infection models:

    • Trypanosoma congolense infection provides a model to study Ms4a8a expression in hepatic macrophages

    • Taenia crassiceps infection allows examination of Ms4a8a+ peritoneal macrophages

  • Tissue samples:

    • Normal intestinal epithelium and colorectal cancer samples can be compared for MS4A8A/MS4A8B expression to understand its role as a differentiation marker

These diverse experimental systems allow researchers to examine Ms4a8a function in different cellular contexts and under various physiological and pathological conditions.

What are the recommended approaches for RNA-seq analysis of Ms4a8a expression?

RNA-seq analysis of Ms4a8a expression requires careful experimental design and analysis. Based on best practices for RNA-seq experiments:

  • Experimental design considerations:

    • Use at least 3-5 biological replicates per condition to account for biological variation

    • Consider paired-end sequencing for better mapping accuracy

    • Aim for sequencing depth of at least 20-30 million reads per sample for gene expression analysis

    • Randomize samples during preparation and dilute to the same concentration

  • Quality control and preprocessing:

    • Assess RNA quality prior to library preparation

    • Remove adapter sequences and low-quality reads

    • Check for PCR duplicates, which should generally be low (approximately 5% for highly expressed genes)

  • Alignment and quantification:

    • Use appropriate alignment tools that can handle spliced alignments

    • Assign reads to genes or transcripts using tools that account for multi-mapping reads

    • Normalize expression data to account for sequencing depth and transcript length

  • Differential expression analysis:

    • Use tools based on negative binomial distribution (e.g., DESeq2) for analysis with biological replicates

    • Account for batch effects and technical variation in the statistical model

When specifically examining Ms4a8a expression, researchers should pay attention to potential alternative splicing events and ensure proper annotation of the gene in the reference genome used for analysis.

What controls and validation techniques are essential in Ms4a8a functional studies?

To ensure robust and reproducible results in Ms4a8a functional studies, the following controls and validation techniques are recommended:

  • Expression validation:

    • Confirm Ms4a8a expression at both mRNA level (qRT-PCR) and protein level (Western blot, immunohistochemistry)

    • Use multiple antibodies targeting different epitopes when available

    • Include positive controls (tissues known to express Ms4a8a) and negative controls

  • Functional studies controls:

    • Include empty vector controls when performing overexpression studies

    • Use multiple independent clones to avoid clone-specific effects

    • Consider inducible expression systems to control timing and level of expression

  • Knockout/knockdown validation:

    • Verify knockdown efficiency at both RNA and protein levels

    • Use multiple siRNA/shRNA constructs to minimize off-target effects

    • Consider CRISPR-Cas9 for complete knockout studies

  • Colocalization studies:

    • Use confocal microscopy with appropriate controls for antibody specificity

    • Perform colocalization analysis with known markers (e.g., membrane markers, differentiation markers)

  • Functional assays validation:

    • Include positive and negative controls in all functional assays

    • Use multiple complementary assays to confirm functional effects

    • Validate key findings in both cell lines and primary cells when possible

These controls and validation techniques help ensure that observed effects are specifically due to Ms4a8a and not experimental artifacts or off-target effects.

What is the relationship between Ms4a8a/MS4A8B and human diseases?

Research has revealed important relationships between Ms4a8a (mouse)/MS4A8B (human) and human diseases:

  • Cancer:

    • MS4A8B expression is detected in normal differentiated intestinal epithelium but is notably absent in human colon carcinoma

    • This differential expression pattern suggests that loss of MS4A8B may be associated with colorectal cancer development or progression

    • The absence of MS4A8B in colonic adenocarcinomas might serve as a helpful diagnostic marker to differentiate between healthy and neoplastic tissue

  • Neurodegenerative diseases:

    • While not specific to MS4A8B, the MS4A gene cluster has been implicated in Alzheimer's disease pathogenesis

    • Common variants in the MS4A gene region are associated with CSF levels of soluble TREM2 (sTREM2), a biomarker for Alzheimer's disease

    • Variants associated with increased CSF sTREM2 are also associated with reduced AD risk and delayed age-at-onset

  • Infectious and inflammatory diseases:

    • MS4A family proteins appear to play roles in various infectious and inflammatory conditions, though specific roles of MS4A8B in human infectious diseases remain to be fully characterized

These findings suggest potential diagnostic and therapeutic applications for Ms4a8a/MS4A8B in various disease contexts, particularly in cancer diagnosis and potentially in modulating inflammatory responses.

How does the MS4A gene family contribute to Alzheimer's disease pathogenesis?

The MS4A gene family, particularly the MS4A gene cluster, has been identified as a key modulator in Alzheimer's disease (AD) pathogenesis through several mechanisms:

  • Modulation of soluble TREM2:

    • Genome-wide association studies have identified common variants in the MS4A gene region that are significantly associated with cerebrospinal fluid (CSF) levels of soluble TREM2 (sTREM2)

    • The top single nucleotide polymorphism (SNP) identified was rs1582763, an intergenic variant nearest MS4A4A

    • This variant explains more than 6% of the variance in sTREM2 levels

  • Association with AD risk:

    • Variants associated with increased CSF sTREM2 are also associated with reduced AD risk and delayed age-at-onset

    • This provides a mechanistic explanation for the original GWAS signal in the MS4A locus for AD risk

  • Cellular mechanisms:

    • MS4A4A and TREM2 colocalize on lipid rafts at the plasma membrane

    • sTREM2 increases with MS4A4A overexpression

    • Antibody-mediated targeting of MS4A4A reduces sTREM2 production

These findings indicate that the MS4A gene family, while not specifically MS4A8A, influences AD pathogenesis through modulation of TREM2, which plays critical roles in microglial activation, survival, and phagocytosis. This connection highlights the broader importance of MS4A family proteins in neurodegenerative diseases and suggests potential therapeutic approaches targeting this pathway.

What potential exists for targeting Ms4a8a in therapeutic applications?

Based on current research, Ms4a8a presents several potential therapeutic applications:

  • Cancer diagnostics and therapy:

    • The absence of MS4A8B in human colonic adenocarcinomas could serve as a diagnostic marker to differentiate between healthy and neoplastic tissue

    • Understanding the mechanisms by which Ms4a8a confers resistance to oxidative stress-induced apoptosis might reveal new therapeutic targets for overcoming treatment resistance in colorectal cancer

    • The role of Ms4a8a in tumor-associated macrophages suggests it could be targeted to reprogram the tumor microenvironment and enhance anti-tumor immunity

  • Immunomodulatory applications:

    • Ms4a8a's role in integrating TLR signaling with M2 macrophage polarization suggests potential applications in diseases characterized by dysregulated inflammation

    • Targeting Ms4a8a might allow fine-tuning of macrophage responses in conditions like chronic infections, autoimmune diseases, or inflammatory disorders

  • Based on MS4A family insights:

    • The role of other MS4A family members in Alzheimer's disease suggests that understanding the broader functions of this protein family could reveal novel therapeutic approaches for neurodegenerative diseases

    • Antibody-mediated targeting approaches that have been successful for other MS4A family members (like MS4A4A) might be applicable to Ms4a8a in appropriate disease contexts

These potential applications require further research to fully characterize Ms4a8a's functions in different cellular contexts and disease states, but they highlight the therapeutic potential of targeting this protein or its pathways.

What are the critical knowledge gaps in our understanding of Ms4a8a biology?

Despite progress in understanding Ms4a8a, several critical knowledge gaps remain:

  • Molecular mechanisms: The precise molecular mechanisms by which Ms4a8a influences cellular functions like differentiation, migration, and apoptosis resistance remain incompletely understood. While it is known to function as an ion channel and potential molecular chaperone, the downstream signaling pathways and molecular interactions require further elucidation.

  • Physiological role in intestinal epithelium: While Ms4a8a/MS4A8B has been identified as a differentiation marker in intestinal epithelium, its specific contributions to intestinal homeostasis, barrier function, and epithelial turnover need further investigation.

  • Regulation of expression: The factors controlling Ms4a8a expression in different cell types and tissues remain partially characterized. Understanding the transcriptional and epigenetic regulation of Ms4a8a would provide insights into its tissue-specific functions.

  • Role in disease progression: The contributions of Ms4a8a to disease progression, particularly in cancer and infectious diseases, need further clarification, especially given its seemingly contradictory effects in different contexts.

  • Human-mouse differences: While Ms4a8a and MS4A8B share homology, potential functional differences between the mouse and human proteins require investigation to enable proper translation of findings to human disease contexts.

Addressing these knowledge gaps will require integrated approaches combining genomics, proteomics, and functional studies in relevant model systems.

What novel technologies and approaches might advance Ms4a8a research?

Several emerging technologies and approaches could significantly advance Ms4a8a research:

  • Single-cell technologies:

    • Single-cell RNA sequencing could reveal the heterogeneity of Ms4a8a expression within tissues and clarify its role in specific cell subpopulations

    • Single-cell proteomics and spatial transcriptomics could map Ms4a8a expression in relation to other markers and tissue architecture

  • CRISPR-based approaches:

    • CRISPR/Cas9 knockout and knockin models would enable precise examination of Ms4a8a function

    • CRISPR activation or repression systems could help study dose-dependent effects

    • Base editing or prime editing could be used to introduce specific mutations corresponding to human variants

  • Structural biology techniques:

    • Cryo-electron microscopy could help determine the three-dimensional structure of Ms4a8a, clarifying its function as an ion channel or scaffold protein

    • Hydrogen-deuterium exchange mass spectrometry could identify binding partners and conformational changes

  • Organoid models:

    • Intestinal organoids would provide physiologically relevant systems to study Ms4a8a in epithelial differentiation and function

    • Co-culture systems with immune cells could examine interactions between epithelial Ms4a8a and immune functions

  • In vivo imaging:

    • Intravital microscopy with fluorescently tagged Ms4a8a could reveal dynamic changes in expression and localization during disease processes

    • PET imaging with radiolabeled antibodies against Ms4a8a could track expression in animal models

These advanced approaches would provide deeper insights into Ms4a8a biology and potentially reveal new therapeutic opportunities targeting this protein or its associated pathways.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.