Recombinant Mouse Metal transporter CNNM3 (Cnnm3)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mouse Metal Transporter CNNM3 (Cnnm3)

Recombinant Mouse Metal transporter CNNM3 (Cnnm3) refers to a genetically engineered version of the mouse CNNM3 protein, which is part of the cyclin M family of magnesium transporters. These proteins play a crucial role in maintaining magnesium homeostasis within cells, a function essential for various cellular processes, including energy metabolism and cell signaling. The recombinant form of CNNM3 is produced through biotechnological methods, allowing for its use in research settings to study magnesium transport mechanisms and their implications in health and disease.

Structure and Function of CNNM3

CNNM3 is a transmembrane protein composed of approximately 707 amino acids in humans, with similar structures in mice. It features three transmembrane domains at its N-terminal region and a C-terminal cystathionine β synthase (CBS) pair domain, also known as the Bateman module. This CBS domain is crucial for binding to phosphatases of regenerating liver (PRLs), which are involved in cancer progression by regulating intracellular magnesium levels .

FeatureDescription
StructureTransmembrane protein with CBS pair domain
FunctionRegulates magnesium homeostasis
Binding PartnersPhosphatases of regenerating liver (PRLs)

Role in Cancer

CNNM3 interacts with PRL-2, a phosphatase implicated in tumor growth and metastasis. The complex formed between CNNM3 and PRL-2 influences intracellular magnesium levels, promoting cell proliferation under certain conditions. Mutations disrupting this interaction, such as the D426A mutation in CNNM3, can reduce cancer cell proliferation, especially in magnesium-deprived environments .

Cancer-Related FunctionMechanism
Cell ProliferationRegulates magnesium levels via PRL-2 binding
Tumor GrowthEnhanced by PRL-2·CNNM3 complex formation

Research Applications

Recombinant Mouse Metal transporter CNNM3 (Cnnm3) is used in research to study magnesium transport mechanisms and their role in disease. It can be employed in assays to detect inhibitors of the PRL-2·CNNM3 complex, which may have therapeutic potential in cancer treatment . Additionally, it facilitates the investigation of magnesium homeostasis and its impact on cellular processes.

Research UseApplication
Magnesium Transport StudiesInvestigating mechanisms of magnesium homeostasis
Cancer ResearchDeveloping inhibitors for PRL-2·CNNM3 complex

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance for arrangement. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50%. You may use this as a reference.
Shelf Life
The shelf life of the product is influenced by various factors including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid form exhibits a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the protein for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The specific tag type will be determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Cnnm3; Acdp3; Metal transporter CNNM3; Ancient conserved domain-containing protein 3; mACDP3; Cyclin-M3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-713
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Cnnm3
Target Protein Sequence
MAAAAAAVVGWLGWVLAAFCLGSTAGEAAPAPGAGLLNFCTEEDSAPGAGSLRGRAAPEA TLCLRLFCSGLANSSWTWVAAEGAGCPEGGRATEPEEAAAPTGEWRALLRLRAEAGHPRS ALLAVRVEPGGGAAEEAAPPWALGLGAAGLLALAAVARGLQLSALALAPAEVQVLRESGS EAERAAARRLEPARRWAGCALGALLLLASLAQAALAVLLYGAAGQRAVPAVLGCAGLVFL VGEVLPAAVSGRWALALAPRALGLSRLAVLLTLPVALPVGQLLELAARPGRLRERVLELA RGGGDPYSDLSKGVLRSRTVEDVLTPLEDCFMLDSGTVLDFSVLASIMQSGHTRIPVYEE ERSNIVDMLYLKDLAIVEPEDCTPLSTITRFYNHPLHFVFNDTKLDAVLEEFKRGKSHLA IVQKVNNEGEGDPFYEVLGLVTLEDVIEEIIKSEILDESEDYSDTKVRKKTVALGAPLKR KEEFSLFKVSDDEYKVKISPQLLLATQRFLSREVDVFSPLRVSEKVLLHLLKHPSVNQEV TFDESNRLAAHHYLYQRSQPVDYFILILQGRVEVEIGKEGLKFENGAFTYYGVSALTAPS SAHQSPVSSRQLIRHDVQPEPADGTRSCTYCPDYTVRALSDLQLIKVTRLQYLNALLATR AQSLPPSPENAELQAIPGSQTRLLGDKSRETAGSTNSRPSIPVEESPGRNPGV
Uniprot No.

Target Background

Function
CNNM3 is likely involved in metal transport.
Gene References Into Functions
  1. Oncogenic PRL-2 controls tumor growth by modulating intracellular magnesium levels through its interaction with the CNNM3 magnesium transporter. PMID: 24632616
Database Links
Protein Families
ACDP family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Widely expressed with highest levels in brain, kidney, liver, lung and heart.

Q&A

What is CNNM3 and what is its biological function?

CNNM3 is a protein-coding gene that functions as a probable metal transporter primarily involved in ion transport processes . It belongs to the CNNM family, which encompasses four members in humans (CNNM1-4) that play key roles in maintaining magnesium homeostasis across different organs . While the exact function of CNNMs remains under investigation, they've been proposed to function either as direct transporters, sensors, or homeostatic factors for magnesium and other divalent cations .

Current structural evidence from prokaryotic orthologs has confirmed that CNNMs function as ion transporters . Specifically, CNNMs are understood to be electroneutral ion antiporters that facilitate magnesium efflux from cells .

What is the structural organization of CNNM3?

CNNM3, like other members of the CNNM family, has a complex multi-domain structure consisting of:

  • An N-terminal extracellular domain

  • A transmembrane domain

  • Two cytosolic domains:

    • A CBS-pair domain (also termed a Bateman domain)

    • A cyclic nucleotide-binding homology (CNBH) domain

The CBS-pair domain is particularly significant as it serves as an interaction site for regulatory proteins including phosphatases of regenerating liver (PRLs) and the small GTPase ARL15 . In CNNM3, key residues His391 and Phe392 within the CBS-pair domain are critical for these protein-protein interactions .

Where is CNNM3 predominantly expressed?

CNNM3 exhibits a ubiquitous expression pattern throughout the body, but shows notably higher expression levels in specific tissues. Research indicates that CNNM3 is most abundantly present in the lung, spleen, and heart tissues . In contrast to some other CNNM family members, CNNM3 is barely detectable in skeletal muscles . This tissue-specific expression pattern may provide insights into the specialized functions of CNNM3 in different physiological contexts.

How can I experimentally study CNNM3-PRL interactions?

The interaction between CNNM3 and phosphatases of regenerating liver (PRLs, particularly PRL2) can be studied using Förster Resonance Energy Transfer (FRET)-based assays. Based on the crystallographic data (PDB ID: 5K22), the distance between the C-terminus of the CNNM3 CBS domain and the N-terminus of PRL2 is approximately 35 Å, which falls within the optimal range for FRET (10-100 Å) .

To implement this approach:

  • Design fusion constructs:

    • C-terminal YPet tag on the CNNM3 CBS domain (residues 301-452)

    • N-terminal CyPet tag on PRL2 (residues 1-167)

  • Express and purify these recombinant proteins from E. coli cultures.

  • Perform spectral measurements by exciting at 435 nm and measuring emissions.

This method has successfully demonstrated binding between CNNM3-YPet and CyPet-PRL2 with a dissociation constant (Kd) of 108 ± 16 nM, comparable to values previously obtained through isothermal titration calorimetry (ITC) .

The assay can also be used to screen for potential inhibitors of the CNNM3-PRL2 interaction by measuring the reduction in FRET signal when test compounds are added to the protein mixture .

What methods can be employed to measure CNNM3 transporter activity?

CNNM3 transporter activity can be assessed using fluorescent indicator-based assays that measure cytosolic Mg²⁺ levels in living cells. A well-established approach employs Magnesium Green, a fluorescent dye sensitive to changes in intracellular magnesium concentration .

The experimental procedure involves:

  • Transfecting cells (e.g., HEK-293T) with a CNNM3 expression construct

  • Loading cells with Magnesium Green dye

  • Measuring fluorescence changes when cells are transferred to Mg²⁺-free solution

Cells overexpressing CNNMs typically show Mg²⁺ efflux when placed in Mg²⁺-free solution, which can be quantified as a percentage drop in fluorescence signal . This approach has been successfully used to demonstrate that CNNM proteins mediate magnesium efflux and that this activity can be modulated by interaction partners such as PRLs and ARL15 .

How does the ARL15-CNNM3 interaction regulate magnesium transport?

Recent research has revealed that the small GTPase ARL15 forms a complex with CNNM3 and regulates its transport activity. The interaction occurs at the CBS-pair domain of CNNM3, with His391 and Phe392 serving as critical residues for ARL15 binding .

The regulatory mechanism involves:

  • Direct binding of ARL15 to the CBS-pair domain of CNNM3

  • Inhibition of CNNM3-mediated Mg²⁺ efflux upon binding

  • Potential coordination with TRPM7 channel activity

Experimental evidence shows that cells co-expressing CNNM proteins and ARL15 display inhibited magnesium efflux compared to cells expressing CNNM proteins alone . Importantly, the ARL15 R95A mutant, which cannot bind to CNNM proteins, fails to inhibit magnesium efflux, confirming that the regulation is dependent on the direct interaction between these proteins .

What is the proposed model for CNNM3's role in coordinated magnesium transport?

Current research suggests a complex model where CNNM3 functions within a coordinated system involving TRPM7 channels and regulatory proteins like ARL15 and PRLs. The model proposes that:

  • CNNMs mediate Mg²⁺ efflux as electroneutral ion antiporters

  • PRLs inhibit Mg²⁺ efflux by binding to CNNMs

  • CNNMs and PRLs stimulate divalent cation uptake by TRPM7

  • ARL15 forms a complex with both TRPM7 and CNNMs, inhibiting both proteins

This model highlights the importance of coordinated regulation of cation transport across the plasma membrane, where CNNM3 participates in a larger protein complex that dynamically regulates cellular magnesium levels .

How can I design and prepare recombinant CNNM3 constructs for functional studies?

For functional studies of CNNM3, researchers can prepare various recombinant constructs based on specific experimental requirements:

  • For full-length studies:

    • Clone the complete mouse CNNM3 coding sequence into appropriate expression vectors

    • Consider fusion tags (e.g., FLAG, mCherry) for detection and visualization

  • For domain-specific studies:

    • CBS domain constructs (residues corresponding to 301-452 in human CNNM3)

    • Transmembrane domain constructs

    • CNBH domain constructs

  • For protein interaction studies:

    • Generate fusion constructs with fluorescent proteins for FRET (e.g., YPet, CyPet)

    • Include appropriate linker sequences (e.g., GS linkers) between domains

Experimental evidence has shown successful expression of these constructs in both bacterial systems (E. coli) for purified protein studies and mammalian cells (HEK-293T) for cellular assays .

What mutations can be introduced to study CNNM3 function and interactions?

Strategic mutations in CNNM3 can provide valuable insights into its function and protein interactions:

DomainMutationFunctional ImpactApplication
CBS-pairD426A (human numbering)Disrupts PRL bindingStudying PRL-dependent regulation
CBS-pairH391K (human numbering)Disrupts ARL15 bindingInvestigating ARL15-dependent regulation
CBS-pairF392K (human numbering)Disrupts ARL15 bindingInvestigating ARL15-dependent regulation

When designing mutational studies:

  • Confirm proper folding of mutant proteins using biophysical techniques (e.g., NMR spectroscopy)

  • Validate the impact on protein interactions using binding assays (e.g., pulldown, co-immunoprecipitation, ITC)

  • Assess functional consequences through transport activity measurements

How can I differentiate between CNNM3's potential roles as a transporter versus a regulatory factor?

Distinguishing whether CNNM3 functions primarily as a direct transporter or as a regulatory factor requires a multi-faceted experimental approach:

  • Direct transport measurements:

    • Electrophysiological recordings in cells expressing CNNM3

    • Radioactive isotope (²⁸Mg) flux measurements

    • Vesicle-based transport assays with purified protein

  • Regulatory function assessment:

    • Proteomic analysis of CNNM3 interaction partners

    • Phosphorylation state analysis under various cellular conditions

    • Transcriptional changes in response to CNNM3 activity

  • Comparative studies:

    • Rescue experiments in CNNM3-deficient systems

    • Cross-complementation with bacterial orthologs with known transport function

Evidence from prokaryotic orthologs supports that CNNMs are ion transporters , but additional experiments are needed to fully characterize the specific transport mechanism and potential regulatory roles of mammalian CNNM3.

What is the significance of CNNM3-PRL interactions in cancer research?

The interaction between CNNM3 and phosphatases of regenerating liver (PRLs) has significant implications for cancer research:

  • PRLs are highly oncogenic phosphatases that promote tumor growth and metastasis

  • CNNM3-PRL complexes can alter magnesium homeostasis in cancer cells

  • Disruption of CNNM-PRL interactions represents a potential therapeutic strategy

The FRET-based screening method described earlier provides a platform for identifying inhibitors of CNNM-PRL interactions that could potentially be developed into novel anticancer therapies . This approach is particularly promising because it targets a specific protein-protein interaction rather than general cellular processes, potentially leading to more targeted therapeutic interventions with fewer side effects.

How does CNNM3 contribute to magnesium homeostasis in physiological and pathological conditions?

CNNM3's role in magnesium homeostasis extends across various physiological and pathological contexts:

  • In normal physiology:

    • CNNM3 mediates Mg²⁺ efflux from cells, contributing to whole-body magnesium balance

    • Its expression in specific tissues (lung, spleen, heart) suggests tissue-specific roles in magnesium handling

  • In pathological conditions:

    • Alterations in CNNM family proteins are linked to diseases including Jalili Syndrome and Familial Hypomagnesemia

    • CNNM dysfunction is also associated with neuropathologic disorders, altered blood pressure, and infertility

    • In cancer, the interaction between CNNMs and PRLs can promote tumor progression

Understanding these roles provides opportunities for therapeutic interventions targeting magnesium transport in various disease states.

What are emerging areas of CNNM3 research with therapeutic potential?

Several promising research directions for CNNM3 have therapeutic implications:

  • Development of small molecule inhibitors:

    • Compounds targeting the CNNM3-PRL interface may have anticancer properties

    • The FRET-based screening method provides a platform for identifying such inhibitors

  • Investigation of the CNNM3-TRPM7-ARL15 regulatory axis:

    • Understanding this complex may reveal new therapeutic targets for disorders of magnesium homeostasis

    • Targeting specific protein interactions could provide precise control over cellular magnesium levels

  • Tissue-specific functions:

    • Exploring CNNM3's role in lung, spleen, and heart may reveal tissue-specific therapeutic applications

    • Understanding how CNNM3 contributes to organ-specific magnesium handling could inform targeted interventions

These research directions highlight the potential of CNNM3 as a therapeutic target across multiple disease contexts, from cancer to disorders of magnesium homeostasis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.