Recombinant Mouse Metal transporter CNNM4 (Cnnm4)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mouse CNNM4

Recombinant Mouse Metal Transporter CNNM4 (Cnnm4) is a laboratory-engineered protein used to study magnesium (Mg²⁺) transport mechanisms and associated pathologies. CNNM4, part of the cyclin and CBS domain divalent metal cation transport mediator family, plays a critical role in Mg²⁺ extrusion across epithelial basolateral membranes . Recombinant versions enable biochemical, structural, and functional analyses, particularly in models of hypomagnesemia, cancer, and Jalili Syndrome .

Gene and Protein Features

  • Gene Name: Cnnm4 (synonyms: Acdp4, Kiaa1592) .

  • Protein Structure:

    • Domains: DUF21 (184–358), cyclin-box (548–578), cNMP-binding (575–695), and two CBS domains (377–438, 445–511) .

    • Molecular Weight: ~86–113 kDa (species- and construct-dependent) .

    • Function: Mg²⁺/Na⁺ exchanger critical for transcellular Mg²⁺ transport .

Production and Purification

Recombinant Mouse CNNM4 is produced using heterologous expression systems, followed by affinity chromatography (e.g., GST/His-tag purification) . Key steps include:

  1. Cloning: Full-length ORF (e.g., residues 1–775) or truncated constructs .

  2. Expression: Optimized in wheat germ or mammalian systems for proper folding .

  3. Validation: Confirmed via SDS-PAGE, immunoblotting, and functional assays .

Mg²⁺ Transport Mechanism

  • Role in Mg²⁺ Homeostasis: CNNM4 extrudes Mg²⁺ by exchanging intracellular Mg²⁺ with extracellular Na⁺, critical for intestinal absorption and enamel formation .

  • Pathological Relevance:

    • Knockout mice exhibit hypomagnesemia, defective amelogenesis, and infertility .

    • Mutations linked to Jalili Syndrome disrupt Mg²⁺ extrusion .

Key Studies Using Recombinant CNNM4

ApplicationFindingsSource
Cancer MetabolismCNNM4-dependent Mg²⁺ efflux suppresses tumor progression via energy metabolism regulation .
Infertility ModelsCNNM4 deficiency perturbs Ca²⁺ influx during sperm capacitation .
Structural BiologyCrystal structures reveal ATP/Mg²⁺ cooperativity in CBS domains .
Therapeutic TargetingPRL-1/CNNM4 interaction inhibition proposed as anticancer strategy .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you require a specific format, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary based on the purchase method and location. Please contact your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. For dry ice shipping, please contact us in advance. Additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to settle the contents. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. This can serve as a reference for your own protocols.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself. Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize developing the specified tag.
Synonyms
Cnnm4; Acdp4; Kiaa1592; Metal transporter CNNM4; Ancient conserved domain-containing protein 4; mACDP4; Cyclin-M4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-771
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Cnnm4
Target Protein Sequence
MAPGGGGGRRDGWPARGRLLLAALLLLWTRAASGQSSPQQSVILGMRLASCNKSCGMNPD GIIFVSEGSTVNLRLYGHSLGDISSNLISFTEVDDAEAVHNSTNCLELTKDLVVQRLVNV SRGNTSGMLVVITKFLRRSENMKLYALCTRPRADGPWTRWTDKDSLLFMVEEHGRFLPLW LHILLVMVLLVLSGIFSGLNLGLMALDPMELRIVQNCGTEKERKYARKIEPIRRKGNYLL CSLLLGNVLVNTSLTILLDNLIGSGIMAVASSTIGIVIFGEILPQALCSRHGLAVGANTI VLTKVFMLLTFPLSFPISKLLDFVLGQEIRTVYNREKLMEMLKVTEPYNDLVKEELNMIQ GALELRTKTVEDIMTQLHDCFMIRSDAILDFNTMSEIMESGYTRIPVFEDEQSNIVDILY VKDLAFVDPDDCTPLKTITRFYNHPVHFVFHDTKLDAMLEEFKKGKSHLAIVQKVNNEGE GDPFYEVLGLVTLEDVIEEIIKSEILDESDMYTDNRTRKRVSVKNKRDFSAFKDTDNELK VKISPQLLLAAHRFLATEVPQFSPSLMSEKILLRLLKYPDVIQELRFNEHNRYCVRHYLY TRNKPADCFVLILQGKVEVEAGKENMKFETGAFSYYGTMALSVAPPDRSPALPTPLSRSA SLSYPDRNTDLTSTSLAGSNQFGSCILGQYVSDFSVRALTDLQYIKITRQQYQNGLMASR MDNSPQPTFDGCATCSENFMERPELPPVDETTTLLNERNSLLHRASEEETI
Uniprot No.

Target Background

Function
CNNM4 is a probable metal transporter. Its interaction with the metal ion chaperone COX11 suggests a role in sensory neuron function. CNNM4 may also play a role in biomineralization and retinal function.
Gene References Into Functions
  1. These results suggest a novel role for CNNM4 in sperm Ca(2+) homeostasis. PMID: 27006114
  2. These findings indicate that CNNM4-dependent Mg(2+) efflux suppresses tumor progression by regulating energy metabolism. PMID: 25347473
Database Links
Protein Families
ACDP family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Cornea, retina, teeth (at protein level). In the retina it is predominantly localized to the outer plexiform layer, inner plexiform layer and ganglion cell layer. In the tooth strongest expression is observed in the cell body of the ameloblasts. Expressed

Q&A

What is CNNM4 and what are its alternative nomenclatures in mouse models?

Cnnm4 (Cyclin M4) is a metal transporter protein involved in magnesium homeostasis. In mouse models, it is also known by several alternative names including Acdp4, Kiaa1592, and 5430430O18Rik . The protein belongs to the ancient conserved domain-containing protein family and functions as a cyclin and CBS domain divalent metal cation transport mediator. Understanding the proper nomenclature is essential when searching literature or databases for comparative studies across different research groups.

What are the key structural domains of mouse CNNM4 protein?

Mouse CNNM4 protein contains several distinctive structural domains that are crucial for its function:

  • A transmembrane DUF21 module that anchors the protein to cellular membranes

  • An intracellular region consisting of:

    • A Bateman module (CBS1 and CBS2 motifs) that can bind nucleotides

    • A cNMP binding domain that forms symmetric homodimers

    • Connecting linkers and a C-terminal tail

The Bateman module forms a twisted disk-like structure in the absence of MgATP, but adopts a flat disk conformation when bound to MgATP. The cNMP domain contains significant hydrophobic interfaces that stabilize dimer formation .

How does recombinant mouse CNNM4 compare to human CNNM4 in terms of structure and function?

Mouse and human CNNM4 share high sequence homology and conserved functional domains. Both proteins form similar structural arrangements with Bateman modules and cNMP binding domains that establish homodimeric assemblies. The key residues involved in dimer formation and magnesium transport are largely conserved between species, allowing mouse models to serve as reasonable proxies for human CNNM4 studies .

What expression systems are optimal for producing functional recombinant mouse CNNM4?

Recombinant mouse CNNM4 can be produced using several expression systems, each with different advantages depending on research requirements:

Expression SystemAdvantagesTypical YieldBest For
Cell-Free ExpressionRapid production, suitable for difficult proteinsModerateStructural studies, initial characterization
E. coliHigh yield, economical, suitable for domainsHighBiochemical assays, antibody production
Mammalian CellsNative post-translational modificationsLow-ModerateFunctional studies, interaction analyses
BaculovirusEukaryotic processing, high yield for full-lengthModerate-HighFull-length protein studies

Cell-free expression systems have been successfully used to produce recombinant mouse CNNM4 with purity levels of ≥85% as determined by SDS-PAGE . For studies requiring properly folded full-length protein with native post-translational modifications, mammalian expression systems are preferable despite potentially lower yields.

What purification strategies yield the highest purity for mouse CNNM4 protein?

Effective purification of recombinant mouse CNNM4 typically involves a multi-step approach:

  • Initial capture using affinity chromatography (commonly His-tag or GST-tag based systems)

  • Intermediate purification via ion exchange chromatography to separate charged variants

  • Polishing step using size exclusion chromatography to achieve final purity and remove aggregates

This approach consistently yields preparations with purity levels ≥85% as determined by SDS-PAGE . When higher purity is required for structural studies or sensitive functional assays, additional chromatography steps or alternative tag systems may be necessary.

The choice of detergents is critical when purifying full-length CNNM4 due to its transmembrane domains. Mild detergents such as DDM (n-Dodecyl β-D-maltoside) or LMNG (Lauryl Maltose Neopentyl Glycol) often provide the best balance between maintaining protein structure and effective solubilization.

How can researchers effectively analyze the dimeric structure of mouse CNNM4's cNMP domain?

The cNMP domain of mouse CNNM4 forms concentration-dependent homodimers that can be analyzed through multiple complementary techniques:

  • Small-angle X-ray scattering (SAXS) allows assessment of macromolecular flexibility, shape, and assembly at low resolution, confirming the elongated arrangement and dimeric nature of the cNMP domain .

  • X-ray crystallography provides high-resolution structural information, revealing the hydrophobic interface (approximately 617 Ų) and key residues involved in dimerization, such as E627, M629, F631, Y639, M642, and Y694 .

  • Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) can determine the oligomeric state in solution under various conditions.

To validate the functional relevance of the dimeric interface, site-directed mutagenesis of key residues can be performed. For instance, mutating the interface residue F631 to alanine yields predominantly monomeric forms, confirming its critical role in dimer stabilization through π-stacking interactions .

What methodologies are most effective for studying the conformational changes in CNNM4 Bateman modules upon nucleotide binding?

Studying conformational changes in CNNM4 Bateman modules requires techniques sensitive to structural transitions:

  • NMR titration experiments are particularly valuable for mapping binding sites and detecting conformational changes upon ligand binding. These experiments have demonstrated that Mg²⁺ co-binding increases ATP affinity to the Bateman module .

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) can identify regions with altered solvent accessibility upon nucleotide binding.

  • FRET-based approaches using strategically placed fluorophores can detect the transition between the "twisted disk" conformation (nucleotide-free state) and the "flat disk" conformation (MgATP-bound state) .

  • Molecular dynamics simulations can provide insights into the dynamic behavior of these conformational changes at atomic resolution.

The Bateman module contains two main clefts (S1 and S2), with S2 accommodating nucleotide binding despite its unusually acidic surface. The electrostatic repulsion between negatively charged residues in S2 and the ATP polyphosphate chain explains the low nucleotide affinity and its increase upon Mg²⁺ co-binding for charge compensation .

What experimental approaches can determine the magnesium transport activity of recombinant mouse CNNM4?

Assessing magnesium transport activity of recombinant mouse CNNM4 can be accomplished through several complementary approaches:

  • Fluorescent magnesium indicators: Mag-fura-2 or similar ratiometric dyes can measure intracellular free Mg²⁺ concentration changes in real-time when CNNM4 is expressed in cellular systems.

  • Radioactive ²⁸Mg²⁺ flux assays: These provide direct quantification of magnesium transport across membranes in reconstituted liposomes or cellular systems expressing CNNM4.

  • Patch-clamp electrophysiology: This technique can measure CNNM4-associated currents and determine transport mechanism characteristics when the protein is expressed in suitable cell lines.

  • Reconstitution in proteoliposomes: Purified recombinant CNNM4 can be incorporated into artificial membrane systems to assess transport activity in a defined environment, eliminating confounding factors from cellular systems.

When designing these experiments, researchers should consider that the exact mechanism of CNNM4-mediated Mg²⁺ transport remains subject to debate . Control experiments using CNNM4 mutants with disrupted nucleotide binding or dimerization interfaces can help establish structure-function relationships.

How does PRL-1 interaction affect mouse CNNM4 function and what methods can characterize this interaction?

The interaction between PRL-1 (an oncogenic phosphatase) and CNNM4 has significant functional implications:

  • PRL-1 binding inhibits CNNM4's activity in Mg²⁺ transport

  • Conversely, CNNM4 binding inhibits PRL-1 phosphatase activity

This reciprocal inhibition can be characterized using:

  • Co-immunoprecipitation assays: To confirm physical interaction between the proteins in cellular contexts.

  • Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC): To determine binding affinity, stoichiometry, and thermodynamic parameters of the interaction.

  • SAXS analysis: This has revealed that one CNNM4 BAT-cNMP-Ctail dimer binds to two separate PRL-1 molecules .

  • Structural modeling: Combining crystallographic data with computational approaches has shown that PRL-1 molecules interact with the Bateman modules but not with the cNMP binding domains .

Functional assays measuring magnesium transport or phosphatase activity in the presence and absence of the binding partner provide insights into the regulatory mechanisms governing this interaction.

What is the connection between mouse CNNM4 and cone-rod dystrophy, and how can animal models help understand this relationship?

CNNM4 mutations are associated with cone-rod dystrophy, a progressive retinal disorder characterized by deterioration of cone and rod photoreceptors . Mouse models expressing mutant forms of CNNM4 can help understand this relationship through:

  • Electrophysiological assessments: Electroretinogram (ERG) recordings can measure photoreceptor function and detect early functional deficits before morphological changes.

  • Histological analyses: Quantification of photoreceptor cell numbers and retinal layer thickness over time can track disease progression.

  • Magnesium homeostasis measurements: Assessing Mg²⁺ levels in retinal tissues can determine whether altered magnesium transport contributes to photoreceptor degeneration.

  • Transcriptomic and proteomic profiling: These approaches can identify dysregulated molecular pathways that connect CNNM4 dysfunction to photoreceptor death.

Researchers have found that CNNM4 dysfunction may lead to altered magnesium homeostasis in photoreceptors, potentially impacting phototransduction cascades that require precise ion balance. Mouse models carrying specific mutations identified in human patients allow direct comparison between clinical phenotypes and molecular mechanisms.

What methods can detect CNNM4 mutations in research and clinical settings?

Several genetic testing approaches can identify CNNM4 mutations in research and clinical settings:

  • Exome sequencing with CNV detection: This comprehensive approach can identify both sequence variants and copy number variations in the CNNM4 gene .

  • Sanger sequencing: Used for validation or when targeting specific exons or known mutation hotspots .

  • Custom gene panels: Often include CNNM4 alongside other retinal dystrophy-associated genes for targeted next-generation sequencing.

  • MLPA (Multiplex Ligation-dependent Probe Amplification): Useful for detecting larger deletions or duplications that might be missed by sequence-based methods.

For research applications, functional validation of identified variants is crucial and may include:

  • In vitro expression studies comparing wild-type and mutant protein

  • Structural analysis to determine how mutations affect protein folding or interactions

  • Magnesium transport assays to assess functional consequences

Clinical genetic testing for CNNM4-related cone-rod dystrophy typically has a turnaround time of approximately 3 weeks for standard orders or 2 weeks for expedited testing .

How can structural data about CNNM4 inform the design of small molecule modulators of its function?

Detailed structural information about CNNM4 provides valuable insights for rational design of small molecule modulators:

  • Target site identification: The crystal structures reveal potential binding pockets, particularly:

    • The S2 cleft in the Bateman module with its unusually acidic surface

    • The interface between CNNM4 and PRL-1

    • The hydrophobic dimerization interface of the cNMP domain

  • Structure-based virtual screening: Computational docking studies can identify potential small molecules that bind to these sites with high affinity and specificity.

  • Fragment-based drug discovery: This approach can identify small chemical fragments that bind to CNNM4 subpockets, which can then be elaborated into more potent and selective compounds.

  • Allosteric modulator design: Understanding the conformational changes between the "twisted disk" and "flat disk" conformations of the Bateman module opens possibilities for designing compounds that stabilize specific states .

Small molecules targeting the PRL-1 interaction site could potentially restore CNNM4 function in contexts where this interaction leads to pathological magnesium dysregulation, while compounds modulating the nucleotide binding site might allow precise control over CNNM4-mediated magnesium transport.

What are the most promising approaches for studying the role of CNNM4 in the context of whole-organism magnesium homeostasis?

Investigating CNNM4's role in whole-organism magnesium homeostasis requires integrated research approaches:

  • Conditional knockout mouse models: Tissue-specific CNNM4 deletion allows investigation of its role in specific organs while avoiding potential embryonic lethality of global knockouts.

  • CRISPR-engineered models: Introducing specific mutations that affect different functional aspects (nucleotide binding, dimerization, PRL-1 interaction) can dissect structure-function relationships in vivo.

  • Multi-tissue magnesium flux measurements: Using stable isotopes (²⁵Mg, ²⁶Mg) to track magnesium movement between tissues over time following dietary manipulation.

  • Integrated physiological monitoring: Combining measurements of magnesium levels in serum, urine, and various tissues with functional readouts (electrophysiology, metabolomics) provides a comprehensive picture of how CNNM4 contributes to organismal magnesium homeostasis.

  • Single-cell RNA sequencing: This approach can identify cell populations where CNNM4 is highly expressed and potentially reveal compensatory mechanisms in CNNM4-deficient models.

These approaches must account for the complexity of magnesium regulation, including compensatory mechanisms through other transporters and hormonal regulation that may mask CNNM4-specific effects unless carefully controlled experimental designs are employed.

What are common challenges in expressing full-length mouse CNNM4 and how can they be overcome?

Researchers frequently encounter several challenges when expressing full-length mouse CNNM4:

ChallengeCauseSolution
Low expression yieldToxicity to host cells due to membrane protein overexpressionUse tightly regulated inducible systems; optimize induction conditions (temperature, inducer concentration, duration)
Protein aggregationImproper folding of transmembrane domainsInclude molecular chaperones (e.g., GroEL/ES); use specialized E. coli strains (C41/C43); express in eukaryotic systems
DegradationProteolytic susceptibilityAdd protease inhibitors throughout purification; identify and mutate proteolytic sites; optimize buffer conditions
Poor solubilityHydrophobic transmembrane regionsScreen different detergents; use fusion partners that enhance solubility; consider expressing domains separately

For particularly challenging expressions, a domain-based approach may be more successful—expressing the Bateman module and cNMP domain separately, then reconstituting the complex for functional studies . Cell-free expression systems have proven effective for producing recombinant mouse CNNM4 with adequate purity (≥85%) .

What experimental controls are essential when studying CNNM4-mediated magnesium transport?

Rigorous control experiments are critical for reliable CNNM4 functional studies:

  • Negative controls:

    • Untransfected/mock-transfected cells to establish baseline transport

    • Inactive CNNM4 mutants (e.g., F631A that disrupts dimerization )

    • Inhibitors of other magnesium transporters to isolate CNNM4-specific effects

  • Positive controls:

    • Known magnesium transport activators/inhibitors

    • Well-characterized related transporters (other CNNM family members)

  • Validation controls:

    • Multiple independent measurement techniques (fluorescent indicators, isotopic flux)

    • Demonstration of magnesium specificity by testing other divalent cations

    • Dose-response relationships to establish physiological relevance

  • Expression controls:

    • Western blotting to confirm comparable expression levels between wild-type and mutant constructs

    • Subcellular localization verification using immunofluorescence or fractionation

    • Surface expression quantification for plasma membrane transporters

These controls help distinguish CNNM4-specific effects from background transport, address potential artifacts from overexpression systems, and ensure reliable interpretation of experimental results.

What are the most promising approaches for elucidating the complete molecular mechanism of CNNM4-mediated magnesium transport?

The molecular mechanism of CNNM4-mediated magnesium transport remains incompletely understood. Future research should focus on:

  • Cryo-electron microscopy: This technique could resolve the full-length CNNM4 structure, including transmembrane domains, providing insights into the complete transport mechanism.

  • Molecular dynamics simulations: With increasing computational power, long-timescale simulations could reveal conformational changes associated with magnesium transport through the protein.

  • Time-resolved structural studies: Using techniques like time-resolved X-ray crystallography or TR-FRET to capture transient conformational states during the transport cycle.

  • Functional reconstitution: Purified CNNM4 incorporated into defined liposome systems with controlled lipid composition would allow detailed kinetic and thermodynamic characterization of transport.

  • Identification of regulatory partners: Proteomic approaches to identify additional proteins that modulate CNNM4 function, beyond the known PRL-1 interaction .

Combining these approaches could resolve persistent questions about whether CNNM4 functions as a direct transporter, a channel, or a regulator of other magnesium transport proteins.

How might CNNM4 research inform therapeutic approaches for magnesium-related disorders?

CNNM4 research has significant therapeutic implications for various conditions:

  • Retinal degeneration: Understanding how CNNM4 mutations lead to cone-rod dystrophy could enable development of gene therapy approaches or small molecule interventions to preserve vision .

  • Cancer metabolism: The interaction between CNNM4 and PRL-1 impacts cellular magnesium levels, which in turn affects cancer cell proliferation. Disrupting or enhancing this interaction could provide novel cancer therapeutic strategies .

  • Magnesium deficiency disorders: Modulating CNNM4 activity could potentially enhance magnesium absorption or retention in conditions characterized by magnesium deficiency.

  • Precision medicine approaches: Genetic testing for CNNM4 variants could identify patients who might benefit from magnesium supplementation or future targeted therapies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.