Recombinant Mouse Metalloendopeptidase OMA1, mitochondrial (Oma1)

Shipped with Ice Packs
In Stock

Description

Introduction

Mitochondria are dynamic organelles essential for cellular energy production and metabolic homeostasis . Their function relies on a quality control system that involves protein machinery regulating fusion and fission . Recombinant Mouse Metalloendopeptidase OMA1, mitochondrial (Oma1) is a key component of this system . OMA1 is an ATP-independent metalloprotease that plays a vital role in the proteolytic inactivation of OPA1 (optic atrophy 1), a dynamin-related GTPase . OMA1's influence on OPA1 impacts mitochondrial dynamics and, consequently, metabolic processes .

Function and Mechanism

OMA1, in conjunction with m-AAA protease isoenzymes, contributes to the proteolytic processing of OPA1 . OPA1 is involved in mitochondrial inner membrane fusion, regulation of mitochondrial morphology, and protection of cells from apoptosis . OMA1-mediated cleavage of OPA1 results in the generation of short, fusion-inactive OPA1 isoforms, leading to mitochondrial network fragmentation .

OMA1 and OPA1 in Mitochondrial Dynamics

OPA1 exists in five distinct protein isoforms: two long (L-OPA1) isoforms that mediate inner-membrane fusion and three short (S-OPA1) fusion-inactive isoforms . Cleavage at OPA1’s S1 and S2 sites releases S-OPA1 into the intermembrane space, producing a steady-state balance of long and short OPA1 isoforms . Stress-sensitive OMA1 metalloprotease cleaves L-OPA1 to short, fusion-inactive S-OPA1 isoforms when the transmembrane potential across the inner membrane (ΔΨ m) is lost, causing the mitochondrial network to collapse to a fragmented population of organelles .

Impact of OMA1 Deficiency

Ablation of OMA1 in mice leads to transcriptional changes in genes of lipid and glucose metabolic pathways and alterations in blood parameters . Oma1-mutant mice exhibit increased body weight due to increased adipose mass and hepatic steatosis, decreased energy expenditure, and impaired thermogenesis .

Cells and tissues from Oma1-null mice exhibit an impairment of OPA1 inactivation in vivo, which is especially significant under stress conditions . Oma1-deficient cells display an increase of highly connected and less-fragmented mitochondria when compared with control cells .

Oma1 cells display low sensitivity to apoptosis compared with control cells, demonstrating that the absence of OMA1 metalloprotease has a profound impact on both pro-fusion and anti-apoptotic activities of OPA1 . Additionally, a significant decrease of mtDNA levels occurs in Oma1 cells .

OMA1 and Metabolic Stress

An intact OMA1-OPA1 system is essential for developing the appropriate adaptive response to different metabolic stressors such as a high-fat diet or cold-shock . Under control conditions, Oma1-deficient mice displayed a slight body weight increase and hepatic steatosis, but on a high-fat diet, these phenotypes were more pronounced .

Regulation of OMA1 Activity

The positively charged amino acids in the N-terminal region of OMA1 are crucial for OMA1 activation upon dissipation of ΔΨ . Decreasing the net positive charge of this region is accompanied by decreased kinetics of stress-induced OPA1 processing, which is almost completely inhibited in the presence of OMA1 .

OMA1 and Mitochondrial Fragmentation

Mitochondrial depolarization results in mitochondrial fragmentation in Oma1 MEFs, whereas tubular mitochondria are maintained in Oma1 MEFs expressing OMA1 . Expression of OMA1 allows fragmentation of the mitochondrial network upon addition of CCCP . Tubular mitochondria are maintained upon mitochondrial depolarization in Oma1 MEFs expressing OMA1 .

Table 1: Effects of OMA1 Deficiency in Mice

PhenotypeObservation
Body WeightIncrease due to increased adipose mass
Hepatic SteatosisPresent
Energy ExpenditureDecreased
ThermogenesisImpaired
Apoptosis SensitivityLow
mtDNA LevelsDecreased
OPA1 ProcessingImpaired in vivo
Mitochondrial MorphologyIncrease of highly connected and less-fragmented mitochondria

Table 2: OMA1 and OPA1 Isoforms

OPA1 IsoformFunctionRegulation
L-OPA1Mediates inner-membrane fusionCleaved by OMA1 under stress conditions
S-OPA1Fusion-inactive; leads to mitochondrial fissionProduced by constitutive cleavage of OPA1 at the S2 site and by OMA1 under stress

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to sediment the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
Oma1; Metalloendopeptidase OMA1, mitochondrial; Overlapping with the m-AAA protease 1 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
80-521
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
SSAQSKELGVLTYRCTVRGDSVLRQGARKVAGVPALAASCSPSCPAVIEARSFRTSARVQ AAPVPLLLLILKPVQKLLAIIVGRGIRKWWQALPPNKKELFKDSVRKNKWRLLLGLSAFG LLFVVFYFTHLEVSPVTGRSKLLLVGKEHFRLLSDLEYEVWMEEFKNDLLPERDPRYLTV KEMVYHLTQCNRDVPGISETNWVVHVVDSPAVNAFVLPNGQVFIFTGLLNSVTDVHQLSF LLGHEIAHAVLGHAAEKASLVHLLDFLGMIFLTMIWAICPRDSLAVLGQWIQSKLQEYMF DRPYSRTLEAEADKVGLQLAAKACADVRASSVFWQQMEFSESLHGYPKLPEWLSTHPSHG NRAEYLDRLIPQALKLREVCNCPPLSGPDPRLLFRLTVKRFLEDSEKEDLNITVKKQKTD ALPMQKQEQIPLTYVLEKRTAG
Uniprot No.

Target Background

Function
Mitochondrial metalloprotease involved in mitochondrial inner membrane quality control. It is activated in response to various mitochondrial stresses, resulting in the proteolytic cleavage of target proteins such as OPA1, UQCC3, and DELE1. Under stress conditions causing mitochondrial membrane potential loss, OMA1 cleaves OPA1 at the S1 site, leading to OPA1 inactivation and inhibition of mitochondrial fusion. It also regulates apoptosis: upon BAK and BAX aggregation, OMA1 cleaves OPA1, remodeling mitochondrial cristae and facilitating cytochrome c release. In depolarized mitochondria, it may serve as a secondary protease for PINK1, mediating PINK1 cleavage and promoting proteasomal degradation. OMA1 may also cleave UQCC3 in response to mitochondrial depolarization. Furthermore, it activates the integrated stress response (ISR): under mitochondrial stress, it cleaves DELE1, generating the processed form S-DELE1, which translocates to the cytosol and activates EIF2AK1/HRI, initiating the ISR. Its role in mitochondrial quality control is crucial for lipid metabolism regulation and maintaining body temperature and energy expenditure under cold stress. OMA1 binds cardiolipin, potentially regulating its protein turnover and is required for the stability of respiratory supercomplexes.
Gene References Into Functions
  1. The m-AAA protease associated with neurodegeneration limits MCU activity in mitochondria. PMID: 27642048
  2. Stress-induced OMA1 activation and guanosine triphosphatase OPA1 cleavage limit mitochondrial fusion and promote neuronal death. PMID: 26783299
  3. The IMQC protease Oma1 is required for the stability of the respiratory supercomplexes and thus balanced and tunable bioenergetic function. PMID: 26365306
  4. OMA1-mediated OPA1 proteolysis plays an important role in the disruption of mitochondrial dynamics in ischemic acute kidney injury. PMID: 24671334
  5. Stress-induced OMA1 activation and autocatalytic turnover regulate OPA1-dependent mitochondrial dynamics. PMID: 24550258
  6. This study shows that OMA1 plays an essential role in the proteolytic inactivation of the dynamin-related GTPase OPA1 and describes its unexpected role in energy metabolism. PMID: 22433842
  7. OMA1 regulates OPA1 cleavage in the mitochondrial inner membrane. PMID: 20038678
Database Links
Protein Families
Peptidase M48 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is mitochondrial OMA1 and what are its primary functions?

Mitochondrial OMA1 is a zinc metalloprotease localized to the inner mitochondrial membrane that functions as a key stress-sensitive protease. Its primary role involves regulating mitochondrial dynamics through proteolytic processing of fusion mediators, particularly optic atrophy-1 (OPA1). OMA1 acts as a critical regulator of the mitochondrial stress response pathway, becoming activated under conditions such as membrane depolarization or oxidative stress . Upon activation, OMA1 cleaves several target proteins including OPA1 at the S1 site and DELE1, which triggers mitochondrial fission and integrated stress response, respectively . This proteolytic mechanism has broad significance for cellular stress responses, apoptosis regulation, and mitochondrial quality control .

What triggers OMA1 activation in mitochondria?

OMA1 activation is primarily triggered by mitochondrial stress conditions, particularly those affecting membrane potential. Experimental evidence demonstrates that dissipation of the mitochondrial membrane potential (ΔΨ) using agents such as CCCP (carbonyl cyanide m-chlorophenylhydrazone) or valinomycin strongly activates OMA1 . The loss of the proton motive force and collapse of ΔΨ are potent activators of OMA1-mediated OPA1 processing . Additionally, combined inhibition of electron transport and ATP synthase (using antimycin A and oligomycin together) effectively triggers OMA1 activation . Oxidative stress also serves as an activation signal, with studies showing that redox-sensing mechanisms involving specific cysteine residues are crucial for OMA1 function under oxidative conditions .

What is the mature form of OMA1 in mitochondria?

The mature form of OMA1 in mammalian mitochondria has a molecular mass of approximately 43 kDa. While bioinformatic analysis had suggested potential targeting sequences of 28 or 86 amino acids (resulting in predicted mature forms of 55 or 49 kDa), experimental N-terminal sequencing identified alanine at position 140 as the N-terminal amino acid of mature OMA1 . This definitively established that the proteolytically active form has a molecular mass of approximately 43 kDa . This mature form is generated through proteolytic processing upon import into mitochondria, as demonstrated by time- and ΔΨ-dependent accumulation of ~45 kDa forms when 35S-labelled OMA1 (~60 kDa precursor) is incubated with isolated mitochondria .

How does the N-terminal region influence OMA1 activation?

The N-terminal region of OMA1, particularly its positively charged amino acids, plays a critical role in stress-induced activation and autocatalytic turnover. Research using OMA1 variants with decreasing net positive charge in this region demonstrated progressively impaired kinetics of stress-induced OPA1 processing . For example, OMA1-6 (with six positively charged residues removed) showed almost completely inhibited stress-induced processing of OPA1 . Additionally, the autocatalytic turnover of OMA1 was increasingly impaired with the removal of these positively charged residues . Functional studies confirmed that OMA1 variants lacking these positive charges failed to support mitochondrial fragmentation upon depolarization, indicating that this region is crucial for activation rather than intrinsic proteolytic activity .

What is known about OMA1's redox-sensing mechanisms?

OMA1 contains a redox-sensing site that regulates its activation under oxidative stress conditions. In yeast, this regulation depends on the formation of a disulfide bridge between specific cysteine residues (Cys272 and Cys332) that contributes to the organization and function of the electron transport chain . In mammalian cells, 3D modeling and mutagenesis studies have identified cysteine 403 as a critical residue in a similar redox sensor . Mutation of this cysteine to alanine (C403A) in mouse sarcoma cells resulted in impaired mitochondrial responses to stress, including reduced fission, resistance to apoptosis, and enhanced mitochondrial DNA release . This redox-sensing mechanism appears to be an evolutionarily conserved feature of OMA1 that links oxidative stress detection to mitochondrial quality control responses.

How can researchers effectively monitor OMA1 activation?

OMA1 activation can be monitored by assessing the conversion of L-OPA1 to S-OPA1, which serves as a reliable readout for OMA1 proteolytic activity. Western blot analysis using OPA1-specific antibodies allows visualization of the different OPA1 isoforms . Under normal conditions, both L-OPA1 and S-OPA1 forms are present, reflecting homeostatic processing by YME1L at the S2/S3 sites . Upon stress-induced OMA1 activation, L-OPA1 is rapidly converted to S-OPA1 through cleavage at the S1 site . Researchers can induce OMA1 activation experimentally using mitochondrial depolarizing agents (CCCP, valinomycin) or oxidative stress inducers, then quantify the L-OPA1:S-OPA1 ratio as an indicator of activation . This approach provides a functional readout of OMA1 activity without requiring direct detection of the protease itself, which can be technically challenging due to low endogenous expression levels.

What techniques are available for studying OMA1 localization and processing?

Several complementary techniques are effective for studying OMA1 localization and processing. Subfractionation of mitochondria combined with protease protection assays can determine the submitochondrial localization of OMA1 . In this approach, mitochondria containing tagged OMA1 are subjected to osmotic disruption of the outer membrane or complete membrane solubilization, followed by protease treatment. OMA1 becomes protease-accessible following outer membrane disruption but not in intact mitochondria, confirming its inner membrane localization . For processing studies, in vitro import assays using radiolabeled OMA1 precursor and isolated mitochondria can track the time-dependent conversion to mature forms . N-terminal sequencing of immunoprecipitated OMA1 definitively identifies processing sites . Additionally, expressing epitope-tagged OMA1 variants in OMA1-deficient cells allows for analysis of processing defects in specific mutants .

What genetic approaches are most effective for OMA1 functional studies?

Multiple genetic approaches have proven valuable for OMA1 functional studies. Complete knockout models include OMA1-deficient mice, which are viable and fertile but exhibit marked obesity with metabolic alterations, reduced energy expenditure, and altered thermogenic response . These models are valuable for studying whole-organism physiological effects of OMA1 deficiency. For cellular studies, CRISPR/Cas9-mediated gene editing has been used to generate OMA1-knockout cell lines . Prime editing has enabled precise point mutations, such as the C403A redox site mutation in mouse sarcoma cells . Complementation studies, where wildtype or mutant OMA1 is reintroduced into knockout cells, allow for structure-function analysis . This approach has been particularly useful for identifying functional domains, as demonstrated by studies expressing OMA1 variants with altered N-terminal regions or catalytic site mutations . Co-expression of different inactive OMA1 variants has revealed intersubunit communication through successful co-immunoprecipitation experiments .

What metabolic phenotypes are observed in OMA1-deficient mice?

OMA1-deficient mice exhibit significant metabolic abnormalities despite being viable and fertile. The primary phenotype is marked obesity due to increased adipose mass, accompanied by hepatic steatosis (fatty liver) . These mice display decreased energy expenditure and impaired thermogenesis, suggesting fundamental alterations in metabolic regulation . Detailed studies have revealed that OMA1 deficiency impacts mitochondrial function in brown adipose tissue and primary adipocytes, which likely contributes to the observed metabolic dysfunction . The phenotype suggests that OMA1 plays an essential role in maintaining proper mitochondrial function for metabolic homeostasis, particularly in tissues with high energy demands or those involved in adaptive thermogenesis . These findings highlight the critical connection between mitochondrial quality control mechanisms and whole-organism metabolic regulation.

How does OMA1 contribute to mitochondrial quality control?

OMA1 serves as a crucial component of the mitochondrial quality control system by facilitating the removal of damaged mitochondria. Upon detecting stress, OMA1 becomes activated and cleaves OPA1, promoting mitochondrial fragmentation . This fragmentation isolates damaged portions of the mitochondrial network, allowing their subsequent clearance through mitophagy . OMA1's stress-sensing mechanisms, including membrane potential monitoring and redox detection, provide rapid response capabilities to various mitochondrial insults . Additionally, OMA1 participates in integrated stress response signaling through cleavage of substrates like DELE1 . Loss of OMA1 function results in impaired stress responses, including disrupted retrograde signaling required for cell survival and increased reactive oxygen species (ROS) production . These functions position OMA1 as a key sensor and effector in the elaborate surveillance system that maintains mitochondrial integrity and function.

What is the relationship between OMA1 and cancer progression?

The relationship between OMA1 and cancer progression is complex and context-dependent. Evidence suggests opposing roles in different tumor types. OMA1 overexpression correlates with poor prognosis in gastric carcinoma, breast cancer, and squamous cell lung carcinoma . Conversely, OMA1 expression is associated with improved survival in lung adenocarcinoma and certain breast carcinomas . In colorectal cancer, OMA1 supports metabolic reprogramming under hypoxic conditions . In mouse sarcoma models, mutation of the OMA1 redox-sensing site (C403A) prevented tumor development specifically in immunocompetent mice but not in immunodeficient models, suggesting immunosurveillance involvement . These findings indicate that OMA1's impact on cancer progression depends heavily on the tumor context and likely reflects differential requirements for mitochondrial activity across cancer types . The preservation of mitochondrial fitness has been shown to limit mouse fibrosarcoma progression, highlighting the complex relationship between mitochondrial dynamics and tumorigenesis .

How does OMA1 interact with other mitochondrial proteases in the regulation of OPA1?

OMA1 works in conjunction with other mitochondrial proteases, particularly YME1L, to regulate OPA1 processing in a complex, context-dependent manner. Under normal conditions, YME1L cleaves OPA1 at S2 or S3 sites to generate short OPA1 isoforms (S-OPA1) that contribute to homeostatic fusion/fission balance . This explains the presence of both long and short OPA1 forms under basal conditions . Upon stress, OMA1 becomes activated and cleaves long OPA1 isoforms (L-OPA1) at the S1 site to generate additional S-OPA1 forms . The coordinated action of these proteases creates a precise regulation system for mitochondrial dynamics. Research using protease-deficient cells has shown that OMA1 and YME1L have partially overlapping but distinct functions in OPA1 processing . Their interplay affects the equilibrium between L-OPA1 and S-OPA1, which determines inner membrane fusion potential, while S-OPA1 alone contributes to mitochondrial DNA maintenance, respiratory complex assembly, and crista structure .

How can researchers distinguish between OMA1-dependent and independent mechanisms of OPA1 processing?

Researchers can distinguish between OMA1-dependent and independent mechanisms of OPA1 processing through careful experimental design. The most definitive approach involves comparing OPA1 processing patterns in wildtype, OMA1-deficient, and YME1L-deficient cells under various conditions . In OMA1-deficient cells, the stress-induced complete conversion of L-OPA1 to S-OPA1 is blocked, while constitutive processing (generating balanced L-OPA1 and S-OPA1 levels) persists . Specific OPA1 forms (labeled as "c" and "e") are absent in cells lacking OMA1, serving as distinctive markers of OMA1-mediated cleavage . Different stressors can help identify the involvement of each protease—membrane potential dissipators (CCCP, valinomycin) strongly activate OMA1-dependent processing, while other conditions may differentially affect YME1L activity . Complementation experiments, where wildtype or mutant OMA1 is reintroduced into knockout cells, can confirm OMA1-specific effects . Finally, examining mitochondrial morphology provides functional confirmation, as stress-induced mitochondrial fragmentation is blocked in OMA1-deficient cells but restored upon reintroduction of functional OMA1 .

What expression systems are most suitable for producing recombinant mouse OMA1?

When producing recombinant mouse OMA1, researchers must consider the complex processing and activation mechanisms of this protease. Mammalian expression systems (particularly HEK293 cells with tetracycline-inducible expression) have been successfully used to express epitope-tagged OMA1 variants for functional and biochemical studies . This approach allows proper mitochondrial targeting and processing to the mature ~43 kDa form. For mechanistic studies, expressing catalytically inactive variants (OMA1-E324Q) has proven valuable, as these accumulate without undergoing autocatalytic degradation . Cell-free translation systems have been employed to generate radiolabeled OMA1 precursors for mitochondrial import studies . When using bacterial systems for bulk protein production, researchers should consider expressing only the mature form (starting at position A140) rather than the full precursor to improve solubility and avoid targeting sequence complications . For any expression system, including C-terminal epitope tags (myc, flag) has been more successful than N-terminal tags, which may interfere with mitochondrial import signals .

What are the critical controls for validating OMA1 activity in experimental systems?

Validating OMA1 activity in experimental systems requires several critical controls. First, comparing OPA1 processing patterns between wildtype and OMA1-knockout cells provides a crucial negative control . Complementation with wildtype OMA1 should restore stress-induced OPA1 processing, while catalytically inactive OMA1-E324Q should not . When studying specific OMA1 functions, comparing the effects of point mutations to both wildtype and knockout backgrounds helps distinguish partial from complete loss of function . For stress-activation studies, time-course experiments with different stressors help characterize activation kinetics . Mitochondrial morphology analysis provides a functional readout, as OMA1's effect on OPA1 directly impacts fusion/fission balance . When studying redox-sensing, comparing cysteine mutants to wildtype under oxidative stress conditions is essential . For intersubunit communication studies, co-expressing different inactive variants tests complementation . Finally, subcellular fractionation controls confirm proper mitochondrial localization of expressed OMA1 variants .

How can researchers quantitatively assess OMA1-mediated effects on mitochondrial dynamics?

Quantitative assessment of OMA1-mediated effects on mitochondrial dynamics requires multi-parameter approaches. The primary biochemical readout involves quantifying the L-OPA1:S-OPA1 ratio using western blot densitometry, which directly reflects OMA1 proteolytic activity toward its key substrate . For microscopy-based morphology analysis, researchers should classify mitochondrial networks into distinct phenotypes (tubular, intermediate, fragmented) and count cells in each category across multiple experiments . This approach was successfully used to demonstrate that OMA1-deficient cells maintain tubular mitochondria under stress conditions where wildtype cells exhibit fragmentation . Live-cell imaging with fluorescently-labeled mitochondria allows dynamic tracking of fission events following OMA1 activation . Functional consequences can be assessed by measuring membrane potential (using potentiometric dyes), oxygen consumption rates, ATP production, and mitochondrial DNA release . In stress-response studies, researchers should quantify apoptotic markers (cytochrome c release, caspase activation) as downstream effects of OMA1-mediated mitochondrial fragmentation . Together, these approaches provide comprehensive quantitation of OMA1's impact on mitochondrial dynamics and function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.