Recombinant Mouse Metallophosphoesterase 1 (Mppe1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. To ensure a specific tag, please inform us during your order, and we will prioritize its inclusion.
Synonyms
Mppe1; Pgap5; Metallophosphoesterase 1; Post-GPI attachment to proteins factor 5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-396
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Mppe1
Target Protein Sequence
MALVRWGLKRQNFHPLRRRRRALLLKLTVVIISVLLFCEYFIYYLVLFRCHWPEVKTLAH GGRQEPVLKAMFLADTHLLGEIRGHWLDKLRREWQMERAFQTALWLLQPEVVFILGDIFD EGKWSSDQAWADDVQRFQRMFRHDSHVQLKVVIGNHDVGFHYQMSKYRIKRFEKVFGSER LLSLKGVNFVMVNSVAMEGDGCIICSEEEAELREISRKLNCSQEVPGSSQCDREPEPRLP LSAPVLLQHYPLYRASDANCSGEDAAPPEERNVPFEEKYDVLSREASQKLLWWLRPRLVL SGHTHSACEVLHPGGAPEVSVPSFSWRNRNNPSFIMGSLTSRDYALSKCYLPFEDTVLTM YGAAAGFLMILILVHFEHLPSPFLCGWKLCRLHMRR
Uniprot No.

Target Background

Function
Metallophosphoesterase 1 (MPPE1) is essential for the trafficking of glycosylphosphatidylinositol (GPI)-anchored proteins from the endoplasmic reticulum to the Golgi apparatus. It functions in GPI-anchor lipid remodeling by removing an ethanolamine-phosphate (EtNP) side chain from the second mannose (Man2) residue of the GPI precursor. This enzymatic activity is crucial for the efficient transport of GPI-anchored proteins.
Database Links
Protein Families
Metallophosphoesterase superfamily, MPPE1 family
Subcellular Location
Golgi apparatus, cis-Golgi network membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is Metallophosphoesterase 1 (Mppe1) and what experimental systems are best suited for studying its function?

    Metallophosphoesterase 1 (Mppe1) is a member of the calcineurin-like phosphoesterase superfamily that contains metal binding and active sites similar to serine/threonine phosphoprotein phosphatase catalytic subunits . The protein is primarily involved in regulating the transport of glycosylphosphatidylinositol-anchored proteins from the endoplasmic reticulum to the Golgi .

    For studying Mppe1 function, researchers should consider:

    • Cell-based systems: Human HCC cell lines (HuH-7 and HepG2) have been successfully used to investigate Mppe1 function through knockdown experiments .

    • Animal models: Xenograft tumor models in nude mice have proven effective for studying Mppe1's role in tumor growth in vivo .

    • Recombinant protein systems: Wheat germ expression systems have been employed to produce recombinant MPPE1 proteins for biochemical studies .

    When selecting an experimental system, consider that Mppe1's putative active sites (comparable to D77, H79, D119 in human MPPE1) are critical for function, and mutations near these sites may influence enzyme activity .

  • How should researchers design experiments to study Mppe1 expression patterns in normal versus diseased tissues?

    When designing experiments to investigate Mppe1 expression patterns, researchers should implement a systematic approach that accounts for tissue specificity and disease context:

    Methodological approach:

    1. Sample selection: Include paired samples (tumor and adjacent non-tumor tissues) to allow for direct comparison within the same genetic background .

    2. Expression analysis techniques:

      • RT-qPCR for quantitative mRNA expression analysis

      • Western blotting for protein expression levels

      • Immunohistochemistry for spatial distribution within tissues

    3. Data mining strategy: Utilize publicly available databases such as GEO and TCGA to validate findings across larger datasets .

    4. Controls: Include appropriate positive and negative controls, and consider using multiple reference genes for normalization.

    Example from research findings:
    Analysis of MPPE1 expression in hepatocellular carcinoma showed significantly increased expression in tumor samples compared to adjacent non-tumor tissues across multiple GEO datasets .

  • What are the optimal conditions for expressing and purifying recombinant mouse Mppe1 protein?

    The successful expression and purification of recombinant mouse Mppe1 requires careful consideration of expression systems, purification methods, and protein stabilization:

    Expression systems comparison:

    SystemAdvantagesConsiderationsRecommended for
    Wheat germEukaryotic post-translational modifications, handles complex proteinsLower yieldStructural studies
    HEK-293 cellsMammalian system, proper folding and modificationsTime-consuming, higher costFunctional studies
    E. coliHigh yield, cost-effectiveMay lack proper folding/modificationsInitial screening

    Purification strategy:

    1. Use affinity tags that don't interfere with protein function (GST or His tags are common)

    2. Include metal chelators in buffers to preserve metallophosphoesterase activity

    3. Optimize buffer conditions (pH 7.0-7.5 typically optimal)

    4. Consider size exclusion chromatography as a final purification step for high purity

    Storage recommendations:

    • Add glycerol (10-20%) to prevent freeze-thaw damage

    • Store at -80°C in small aliquots to avoid repeated freeze-thaw cycles

    • Include reducing agents if cysteine residues are present

  • How should researchers validate Mppe1 knockdown efficiency in experimental models?

    Validating Mppe1 knockdown efficiency requires a multi-level approach to ensure both transcriptional and translational suppression:

    Validation protocol:

    1. mRNA level validation:

      • RT-qPCR with specific primers spanning different exons

      • Include multiple reference genes for normalization

      • Calculate relative expression using 2^-ΔΔCt method

    2. Protein level validation:

      • Western blotting with specific antibodies

      • Densitometric analysis of band intensity normalized to loading controls

      • Consider temporal dynamics (typically assess 48-72h post-transfection)

    3. Functional validation:

      • Assess downstream effects on known pathways

      • Phenotypic assays (proliferation, migration, etc.)

    Example from literature:
    In studies of MPPE1 in HCC cell lines, knockdown validation was performed using both western blotting and functional assays, which demonstrated significant inhibition of cell proliferation (p < 0.001) following successful MPPE1 silencing .

  • What phenotypic assays are most informative when studying the function of Mppe1 in cell models?

    Based on current research, the following phenotypic assays provide comprehensive insights into Mppe1 function:

    Cell proliferation assays:

    • MTT or MTS colorimetric assays

    • BrdU incorporation assay for DNA synthesis

    • Colony formation assay for long-term effects

    Cell cycle analysis:

    • Flow cytometry with propidium iodide staining

    • Assessment of G0/G1, S, and G2/M phase distribution

    Apoptosis assessment:

    • Annexin V/PI staining followed by flow cytometry

    • PARP cleavage detection by western blotting

    • Caspase activity assays

    Migration and invasion assays:

    • Transwell migration assay

    • Wound healing/scratch assay

    • Matrigel invasion assay

    EMT marker analysis:

    • Assessment of E-cadherin and N-cadherin expression

    • Immunofluorescence for morphological changes

    Research example:
    Studies showed knockdown of MPPE1 in HCC cells significantly inhibited cell proliferation, induced G0/G1 cell cycle arrest, increased the percentage of apoptotic cells, and reduced cell invasion and migration capabilities (p < 0.05) .

Advanced Research Questions

  • How can researchers design experiments to investigate the molecular mechanisms underlying Mppe1's regulation of cell cycle progression?

    Investigating Mppe1's role in cell cycle regulation requires a comprehensive experimental design that examines both direct and indirect mechanisms:

    Experimental design framework:

    1. Temporal analysis of cell cycle regulators:

      • Synchronize cells at different cell cycle phases using thymidine block or serum starvation

      • Analyze expression of cyclins, CDKs, and CDK inhibitors at defined time points after Mppe1 manipulation

      • Use western blotting, qPCR, and immunofluorescence to track changes

    2. Phosphorylation status analysis:

      • Assess Rb phosphorylation status

      • Examine CDK substrate phosphorylation

      • Consider phosphoproteomic approaches to identify novel targets

    3. Interaction studies:

      • Co-immunoprecipitation to identify Mppe1-interacting proteins

      • Proximity ligation assay to verify interactions in situ

      • Use of phosphatase inhibitors to determine if enzymatic activity is required

    4. Rescue experiments:

      • Complementation with wild-type vs. catalytically inactive Mppe1

      • Expression of downstream effectors to bypass Mppe1 depletion

    Research findings:
    Studies have demonstrated that MPPE1 knockdown in HCC cells significantly increased the proportion of cells in G0/G1 phase and reduced the proportion in S phase, indicating a critical role in G0/G1 to S phase transition . This suggests a potential role in regulating the phosphorylation status of proteins controlling this checkpoint.

  • What methodological considerations are important when investigating the potential of Mppe1 as a therapeutic target in disease models?

    Exploring Mppe1 as a therapeutic target requires rigorous methodology across in vitro, in vivo, and translational studies:

    In vitro target validation:

    1. Enzyme activity assays:

      • Develop phosphatase activity assays with physiologically relevant substrates

      • Screen for selective inhibitors using biochemical and cell-based assays

      • Determine IC50 values and selectivity profiles

    2. Cellular models:

      • Use both genetic (shRNA, CRISPR) and pharmacological approaches

      • Assess dose-response relationships across multiple cell lines

      • Evaluate effects on non-target cells to assess specificity

    In vivo evaluation:

    1. Animal model selection:

      • Consider xenograft models for initial proof-of-concept

      • Develop genetically engineered mouse models for tissue-specific studies

      • Use orthotopic models to recapitulate the tumor microenvironment

    2. Treatment regimen design:

      • Determine pharmacokinetic properties of inhibitors

      • Establish dosing schedule based on target engagement

      • Include relevant controls and clinically approved standards of care

    Translational considerations:

    1. Biomarker development:

      • Identify patient populations likely to respond based on Mppe1 expression/mutation

      • Develop assays to measure target engagement in vivo

    2. Resistance mechanisms:

      • Investigate potential compensatory pathways

      • Explore rational combination strategies

    Research context:
    Studies have shown that xenograft tumor models in nude mice demonstrate significant reduction in tumor weight and volume (p = 0.049) upon MPPE1 knockdown , providing initial validation of Mppe1 as a potential therapeutic target.

  • How should researchers approach the analysis of contradictory data regarding Mppe1 expression across different tissue types or disease states?

    When faced with contradictory data on Mppe1 expression or function, researchers should implement a systematic approach to resolve discrepancies:

    Data reconciliation framework:

    1. Methodological variation analysis:

      • Compare sample preparation protocols (fresh vs. FFPE tissues)

      • Evaluate antibody specificity and detection methods

      • Assess normalization strategies across studies

    2. Context-dependent expression:

      • Stratify samples by disease stage, grade, and etiology

      • Consider cellular heterogeneity within tissues

      • Analyze microenvironmental factors that might influence expression

    3. Meta-analysis approach:

      • Pool data from multiple sources with strict inclusion criteria

      • Apply statistical methods to account for inter-study variability

      • Use forest plots to visualize consistency across studies

    4. Validation in independent cohorts:

      • Design prospective studies with standardized protocols

      • Include multiple methodologies (qPCR, IHC, Western blot)

      • Consider single-cell approaches to resolve cellular heterogeneity

    Case example:
    In MPPE1 research, data extracted from the TCGA showed increased MPPE1 expression in HCC tumor samples compared to adjacent nontumor tissues, though the difference was not statistically significant . This contrasted with GEO data showing significant overexpression. The authors attributed this discrepancy to the limited number of nontumor samples in the TCGA analysis, highlighting the importance of sample size and cohort selection in resolving contradictory findings .

  • What experimental approaches are most effective for elucidating the biochemical mechanism of Mppe1's phosphoesterase activity?

    Understanding the biochemical mechanism of Mppe1's phosphoesterase activity requires specialized approaches focusing on structure-function relationships:

    Structural analysis:

    1. Protein structure determination:

      • X-ray crystallography of purified recombinant Mppe1

      • Cryo-EM for larger complexes

      • Homology modeling based on related phosphoesterases

    2. Active site mapping:

      • Site-directed mutagenesis of putative catalytic residues

      • Metal-binding site characterization using spectroscopic methods

      • Inhibitor binding studies

    Enzymology approaches:

    1. Substrate identification:

      • Phosphoproteomic analysis comparing wild-type and knockout/knockdown cells

      • In vitro substrate screening using peptide or protein arrays

      • Targeted validation of candidate substrates

    2. Kinetic characterization:

      • Determine kcat, KM, and catalytic efficiency

      • Evaluate pH and metal ion dependence

      • Assess product inhibition and regulation

    Regulatory mechanism investigation:

    1. Post-translational modifications:

      • Mass spectrometry to identify PTMs on Mppe1

      • Generate phospho-mimetic and phospho-deficient mutants

      • Assess impact on localization and activity

    2. Protein-protein interactions:

      • Identify binding partners through AP-MS

      • Characterize the impact of interactions on activity

      • Map interaction domains through truncation mutants

    Relevance to research:
    Analysis of the MPPE1 sequence has revealed that the mutation site (p. E83G) is close to putative active sites (D77, H79, D119), suggesting this mutation may influence enzyme activity . This structural insight provides a foundation for further mechanistic studies of how mutations affect function.

  • How can researchers design experiments to investigate Mppe1's role in epithelial-mesenchymal transition (EMT) in cancer progression?

    Investigating Mppe1's role in EMT requires a comprehensive experimental design that captures the dynamic nature of this process:

    Experimental design strategy:

    1. EMT marker analysis:

      • Track changes in epithelial markers (E-cadherin, ZO-1) and mesenchymal markers (N-cadherin, vimentin)

      • Analyze EMT transcription factors (Snail, Slug, ZEB1/2, Twist)

      • Use both protein (western blot, immunofluorescence) and mRNA (qPCR) analyses

    2. Morphological and functional assessment:

      • Phase-contrast microscopy for morphological changes

      • Cytoskeletal reorganization (F-actin staining)

      • Cell adhesion, migration, and invasion assays

    3. Mechanistic investigations:

      • Signaling pathway analysis (TGF-β, Wnt, Notch)

      • Chromatin immunoprecipitation for transcriptional regulation

      • Use of pathway inhibitors to establish causality

    4. In vivo validation:

      • Orthotopic models to examine metastatic potential

      • Circulating tumor cell analysis

      • Histological examination of primary tumors and metastases

    Controls and validations:

    • Positive controls: TGF-β treatment to induce EMT

    • Negative controls: E-cadherin overexpression to suppress EMT

    • Rescue experiments: re-expression of Mppe1 in knockout cells

    Research context:
    Studies have shown that knockdown of MPPE1 in HepG2 cells significantly upregulated E-cadherin expression (p = 0.002) while downregulating N-cadherin (p < 0.001) . These findings suggest that MPPE1 may promote EMT in HCC cells, providing a foundation for investigating its role in cancer progression and metastasis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.