Recombinant Mouse Metalloreductase STEAP2 (Steap2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your needs whenever possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
Steap2; Metalloreductase STEAP2; Six-transmembrane epithelial antigen of prostate 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-489
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Steap2
Target Protein Sequence
MESISMMGSPKSLETFLPNGINGIKDARQVTVGVIGSGDFAKSLTIRLIRCGYHVVIGSR NPKFASEFFPHVVDVTHHEDALTKTNIIFVAIHREHYTSLWDLRHLLVGKILIDVSNNMR VNQYPESNAEYLASLFPDSLIVKGFNVISAWALQLGPKDASRQVYICSNNIQARQQVIEL ARQLNFIPVDLGSLSSAKEIENLPLRLFTLWRGPVVVAISLATFFFLYSFVRDVIHPYAR NQQSDFYKIPIEIVNKTLPIVAITLLSLVYLAGLLAAAYQLYYGTKYRRFPPWLDTWLQC RKQLGLLSFFFAVVHVAYSLCLPMRRSERYLFLNMAYQQVHANIENAWNEEEVWRIEMYI SFGIMSLGLLSLLAVTSIPSVSNALNWREFSFIQSTLGYVALLITTFHVLIYGWKRAFAE EYYRFYTPPNFVLALVLPSIVILGKMILLLPCISRKLKRIKKGWEKSQFLDEGMGGAVPH LSPERVTVM
Uniprot No.

Target Background

Function
Metalloreductase with the ability to reduce both Fe(3+) to Fe(2+) and Cu(2+) to Cu(1+). It utilizes NAD(+) as an acceptor.
Gene References Into Functions
  1. Stamp1 and Stamp2 play crucial roles in adipogenesis, but through distinct mechanisms. PMID: 23874564
Database Links
Protein Families
STEAP family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Endosome membrane; Multi-pass membrane protein.

Q&A

What is STEAP2 and how does it function in normal physiology?

STEAP2 (Six-Transmembrane Epithelial Antigen of Prostate 2) is a metalloreductase protein belonging to the STEAP family, which includes four members: STEAP1, STEAP2, STEAP3, and STEAP4. STEAP2 contains an intracellular oxidoreductase domain (OxRD) that enables it to mediate cross-membrane electron transfer from NADPH via FAD and heme . It functions in normal physiology by participating in molecular trafficking within endocytic and exocytic pathways and contributing to the regulation of cell proliferation and apoptosis .

STEAP2 is also known as STAMP1 (Six-Transmembrane Protein of Prostate 1) and is located within the trans-Golgi network. Its ability to cross the plasma membrane suggests it plays significant roles in both secretory and endocytic pathways . Unlike STEAP1, STEAP2 possesses metalloreductase activity, enabling it to participate in metal metabolism, particularly iron and copper reduction, which is essential for cellular homeostasis .

How does recombinant mouse STEAP2 differ from human STEAP2?

Recombinant mouse STEAP2 shares significant structural similarities with human STEAP2, particularly in the transmembrane domain and oxidoreductase regions, but differs in several key aspects:

  • Sequence variations: Mouse STEAP2 consists of 489 amino acids (AA 1-489), with sequence differences that may affect epitope recognition when using antibodies across species .

  • Functional differences: While both human and mouse STEAP2 function as metalloreductases, studies have shown species-specific differences in electron transfer rates and binding affinities for substrates.

  • Binding characteristics: Human STEAP2 has been studied in complex with NADP+ and FAD with a resolution of 3.2 Å by cryo-electron microscopy, revealing specific binding orientations of these cofactors . Comparable detailed structural studies of mouse STEAP2 are less prevalent in the literature.

When designing experiments, researchers should consider these differences, particularly when extrapolating findings from mouse models to human applications. Species-specific antibodies and validation methods are essential when working with recombinant proteins across species.

What are the optimal expression systems for producing functional recombinant mouse STEAP2?

For producing functional recombinant mouse STEAP2, several expression systems have been evaluated, with varying advantages depending on experimental needs:

  • Cell-free protein synthesis (CFPS): This system has been successfully used to produce recombinant mouse STEAP2 (AA 1-489) with a Strep tag . CFPS offers advantages for rapid production and avoids cellular toxicity issues that may arise with membrane protein expression.

  • HEK-293 cells: Human embryonic kidney cells provide a eukaryotic expression system that supports proper folding and post-translational modifications of mouse STEAP2, achieving >90% purity as determined by various analytical methods including Bis-Tris PAGE, anti-tag ELISA, Western Blot, and analytical SEC (HPLC) .

  • Escherichia coli: While bacterial expression systems have been used for STEAP family proteins, they may be less optimal for full-length STEAP2 due to its complex membrane structure with six transmembrane domains, potentially resulting in folding issues and inclusion body formation.

The choice of expression system should be guided by the specific experimental requirements. For structural studies requiring high purity and proper folding, mammalian expression systems like HEK-293 cells are preferable. For functional studies focusing on the oxidoreductase domain, CFPS may provide sufficient quality protein with appropriate activity.

How should researchers design robust mouse model experiments to study STEAP2 function in cancer progression?

When designing mouse model experiments to study STEAP2 function in cancer progression, researchers should implement the following methodological approach:

  • Define clear research questions: Determine whether you're investigating STEAP2's role in tumor initiation, progression, metastasis, or as a therapeutic target. STEAP2 has been specifically implicated in promoting osteosarcoma progression through the PI3K/AKT/mTOR axis and inducing epithelial-mesenchymal transition (EMT) .

  • Select appropriate mouse strains and models:

    • For studying osteosarcoma: Consider orthotopic implantation models where STEAP2-expressing osteosarcoma cells are directly introduced into the tibia

    • For prostate cancer studies: Genetically engineered mouse models with tissue-specific STEAP2 overexpression

    • For mechanistic studies: Consider xenograft models with STEAP2 knockout or overexpression using CRISPR/Cas9 technology

  • Implement rigorous experimental design principles:

    • Adequate sample sizing with power calculations

    • Randomization of animals to treatment groups

    • Blinding of researchers during assessment of outcomes

    • Inclusion of appropriate controls (positive, negative, and vehicle)5

  • Measure relevant endpoints: For STEAP2 studies in cancer, consider:

    • Tumor growth kinetics

    • Metastatic spread

    • EMT marker expression (E-cadherin, N-cadherin, Vimentin)

    • Activation status of PI3K/AKT/mTOR pathway components

    • Iron metabolism parameters

  • Validate findings in multiple models: Cross-validate key findings across different mouse strains or alternative cancer models to ensure robustness .

  • Consider the interaction with EFEMP2: Design experiments that account for the regulatory relationship between EFEMP2 and STEAP2, as EFEMP2 has been shown to modulate STEAP2 expression in osteosarcoma .

Following these principles will help ensure that experiments generate reproducible and translatable results in STEAP2 cancer research.

What methodologies are most effective for analyzing STEAP2 electron transfer mechanisms?

Analyzing STEAP2 electron transfer mechanisms requires specialized methodologies that can capture the stepwise process of electron movement from NADPH through FAD to heme and ultimately to metal substrates:

  • Spectroscopic techniques:

    • UV-visible spectroscopy to monitor changes in the oxidation states of FAD and heme

    • Electron paramagnetic resonance (EPR) to detect and characterize transient radical species during electron transfer

    • Stopped-flow spectroscopy for capturing rapid kinetics of electron transfer events

  • Electrochemical methods:

    • Cyclic voltammetry to determine redox potentials of FAD and heme cofactors

    • Protein film voltammetry for direct measurement of electron transfer rates

  • Structural approaches combined with functional assays:

    • Site-directed mutagenesis of key residues involved in cofactor binding

    • Cryo-electron microscopy (as used for human STEAP2) to visualize binding of NADP+ and FAD

    • Hydrogen-deuterium exchange mass spectrometry to identify conformational changes during electron transfer

  • Metal reduction assays:

    • Ferric reductase assays using Fe³⁺-NTA as substrate

    • Monitoring reduction of copper using bathocuproine disulfonate

    • Comparative analysis with other STEAP family members (particularly comparing STEAP2 with STEAP1, which lacks the OxRD domain)

  • FAD binding and diffusion studies:

    • Isothermal titration calorimetry to measure binding affinity of FAD

    • Studies exploiting the finding that FAD reduced by STEAP2 can be utilized by STEAP1, suggesting FAD diffusibility

These methodologies can be combined to create a comprehensive understanding of the STEAP2 electron transfer mechanism, particularly focusing on the interaction between the oxidoreductase domain and the transmembrane domain containing the heme group.

How can researchers effectively measure and compare the metalloreductase activity of mouse STEAP2 with other STEAP family members?

To effectively measure and compare metalloreductase activity of mouse STEAP2 with other STEAP family members, researchers should implement a multi-faceted approach:

  • Standardized metal reduction assays:

    • Ferric reductase activity: Monitor the reduction of Fe³⁺ to Fe²⁺ using ferrozine as a colorimetric indicator that forms a complex with Fe²⁺

    • Cupric reductase activity: Measure Cu²⁺ to Cu⁺ reduction using bathocuproine disulfonate (BCS) as a Cu⁺-specific chelator

    • Control experiments should include known inhibitors of metalloreductases to confirm specificity

  • Kinetic parameter determination:

    • Measure K<sub>m</sub> and V<sub>max</sub> values for different metal substrates

    • Determine the apparent affinity for NADPH as electron donor

    • Compare catalytic efficiency (k<sub>cat</sub>/K<sub>m</sub>) across STEAP family members

  • Comparative analysis framework:

    STEAP Family MemberDomainsFe³⁺ Reduction RateCu²⁺ Reduction RateNADPH Binding Affinity
    STEAP1TMD only+++N/A (requires partner)
    STEAP2TMD+OxRD+++High
    STEAP3TMD+OxRD++++Medium
    STEAP4TMD+OxRD++++High

    Note: This table represents a theoretical framework based on literature findings; actual values should be experimentally determined.

  • Domain swapping experiments:

    • Create chimeric proteins between STEAP2 and other family members

    • Determine which domains contribute to substrate specificity and catalytic efficiency

  • Consider cofactor dynamics:

    • Assess whether FAD remains bound or diffuses between proteins as observed with human STEAP2

    • Determine whether heme binding characteristics differ between STEAP family members

  • Membrane environment considerations:

    • Evaluate activity in different lipid compositions as membrane proteins are influenced by their lipid environment

    • Compare activity in native membranes versus reconstituted systems

When analyzing results, researchers should note that STEAP2 has been observed to reduce ferric nitrilotriacetic acid (Fe³⁺-NTA) significantly slower than STEAP1, possibly due to poor Fe³⁺-NTA binding to the highly flexible extracellular region in STEAP2 . This highlights the importance of considering substrate binding as well as electron transfer capability when comparing metalloreductase activities.

How does STEAP2 contribute to cancer progression mechanisms, particularly in osteosarcoma?

STEAP2 contributes to cancer progression through multiple molecular mechanisms, with particularly well-documented roles in osteosarcoma:

  • Epithelial-Mesenchymal Transition (EMT) induction:

    • STEAP2 promotes EMT in osteosarcoma cells through activation of the PI3K/AKT/mTOR signaling axis

    • EMT is characterized by loss of epithelial markers (E-cadherin) and gain of mesenchymal markers (N-cadherin, vimentin)

    • This transition enhances cancer cell motility, invasiveness, and resistance to apoptosis

  • Cellular infiltration and migration enhancement:

    • STEAP2 expression correlates with increased cellular infiltration and migration capabilities

    • Studies have shown that STEAP2 is overexpressed in highly invasive osteosarcoma and subclone cell lines

    • The transmembrane localization of STEAP2 may facilitate interactions with extracellular matrix components

  • Interaction with EFEMP2:

    • EFEMP2 (Epidermal growth factor-containing fibulin-like extracellular matrix protein 2) regulates STEAP2 expression

    • Changes in EFEMP2 expression result in correlating changes in STEAP2 expression

    • EFEMP2-overexpressing osteosarcoma cells exhibit a less invasive phenotype and reduced EMT following STEAP2 inhibition

  • Prognostic correlation:

    • Upregulation of STEAP2 in osteosarcoma tissues positively correlates with malignant phenotype

    • Higher STEAP2 expression is associated with poor patient outcomes, suggesting its potential as a prognostic biomarker

  • Metallic ion homeostasis disruption:

    • As a metalloreductase, STEAP2 influences iron and copper metabolism

    • Altered metal ion homeostasis can promote cancer progression through enhanced DNA synthesis, cell cycle progression, and angiogenesis

The cumulative evidence strongly indicates that STEAP2 promotes osteosarcoma progression primarily through its ability to induce EMT via the PI3K/AKT/mTOR pathway, making it a potential therapeutic target for intervention strategies aimed at halting osteosarcoma progression.

What experimental approaches can help evaluate STEAP2 as a potential immunotherapeutic target in cancer models?

Evaluating STEAP2 as a potential immunotherapeutic target in cancer models requires multi-dimensional experimental approaches:

  • Target validation studies:

    • Immunohistochemical analysis of STEAP2 expression across tumor samples and corresponding normal tissues

    • Quantification of surface-accessible STEAP2 epitopes in tumor cells using flow cytometry

    • Correlation of STEAP2 expression with clinical outcomes in patient cohorts

  • Antibody-based therapeutic development:

    • Generation of monoclonal antibodies targeting STEAP2 extracellular domains

    • Screening antibodies for specific binding to native STEAP2 conformation

    • Evaluation of antibody internalization kinetics in STEAP2-expressing cells

    • Assessment of antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC)

  • CAR-T cell approaches:

    • Design of chimeric antigen receptors (CARs) targeting STEAP2 extracellular epitopes

    • Evaluation of CAR-T cell activation, proliferation, and cytokine release upon STEAP2 recognition

    • Assessment of on-target, off-tumor effects using normal tissues expressing physiological levels of STEAP2

  • Combination therapies:

    • Testing STEAP2-targeted immunotherapies in combination with:

      • PI3K/AKT/mTOR pathway inhibitors (synergizing with STEAP2's role in EMT)

      • Immune checkpoint inhibitors (PD-1/PD-L1 blockade)

      • Traditional chemotherapeutics used in osteosarcoma treatment

  • Experimental design considerations:

    • Use of orthotopic mouse models that recreate the bone microenvironment for osteosarcoma studies

    • Implementation of humanized mouse models for testing human-specific immunotherapeutics

    • Rigorous implementation of randomization, blinding, and adequate sample sizes5

  • Biomarker development:

    • Identification of predictive biomarkers for response to STEAP2-targeted immunotherapy

    • Development of companion diagnostics to measure STEAP2 expression levels

    • Monitoring of soluble STEAP2 in patient serum as a potential pharmacodynamic marker

  • Safety assessments:

    • Comprehensive screening of STEAP2 expression in normal tissues to predict potential on-target, off-tumor toxicities

    • Assessment of cross-reactivity with other STEAP family members

    • Development of safety switch mechanisms (e.g., inducible caspase-9) for cellular therapies

The evaluation of STEAP2 as an immunotherapeutic target should be particularly focused on osteosarcoma and prostate cancer models, where STEAP2 overexpression has been most clearly documented . The membrane localization of STEAP2 makes it accessible to antibody-based therapies, while its role in cancer progression suggests that targeting STEAP2 could provide therapeutic benefits beyond simple cytotoxicity by potentially reversing EMT and reducing metastatic potential.

What are the most significant challenges in purifying functional recombinant mouse STEAP2, and how can they be overcome?

Purifying functional recombinant mouse STEAP2 presents several significant challenges due to its complex membrane protein nature. Here are the major challenges and methodological solutions:

  • Challenge: Membrane protein solubilization

    Solutions:

    • Implement a detergent screening approach to identify optimal solubilization conditions

    • Consider using mild detergents like n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG)

    • Explore alternative membrane mimetics such as nanodiscs, amphipols, or styrene maleic acid lipid particles (SMALPs)

    • For difficult-to-solubilize constructs, consider cell-free protein synthesis systems that can directly incorporate STEAP2 into preformed liposomes or nanodiscs

  • Challenge: Maintaining cofactor association

    Solutions:

    • Supplement purification buffers with FAD and heme precursors

    • Monitor spectroscopically for cofactor incorporation (FAD: 450 nm; heme: 410-420 nm)

    • Consider that FAD may be diffusible rather than tightly bound, as observed in human STEAP2

    • Verify functionality using metalloreductase activity assays post-purification

  • Challenge: Preserving the native transmembrane domain structure

    Solutions:

    • Use expression systems that support proper membrane protein folding (e.g., HEK-293 cells)

    • Implement quality control steps including analytical size exclusion chromatography

    • Consider fluorescence-based thermal stability assays to optimize buffer conditions

    • Validate structural integrity through limited proteolysis and circular dichroism

  • Challenge: Low expression yields

    Solutions:

    • Optimize codon usage for the expression host

    • Test inducible expression systems with fine-tuned expression parameters

    • Consider fusion partners (e.g., GFP, MBP) that can improve folding and expression

    • Evaluate different affinity tags (His, Strep, FLAG) for optimal purification efficiency

  • Challenge: Heterogeneity in post-translational modifications

    Solutions:

    • Characterize glycosylation patterns using mass spectrometry

    • Consider enzymatic deglycosylation if necessary for structural studies

    • Use site-directed mutagenesis to eliminate non-essential modification sites

    • Implement multi-step purification strategies including ion exchange and size exclusion chromatography

  • Challenge: Verifying functional activity

    Solutions:

    • Develop robust metalloreductase activity assays specific for STEAP2

    • Compare activity metrics with native STEAP2 when possible

    • Implement orthogonal functionality tests such as metal binding assays

    • Consider reconstitution into proteoliposomes for transmembrane electron transfer studies

By implementing these methodological solutions, researchers can overcome the challenges associated with purifying functional recombinant mouse STEAP2, enabling subsequent structural and functional studies that contribute to understanding its role in normal physiology and disease states.

How can researchers troubleshoot inconsistent results when studying STEAP2-mediated electron transfer in experimental systems?

When encountering inconsistent results in STEAP2-mediated electron transfer studies, researchers should implement a systematic troubleshooting approach:

  • Protein quality assessment:

    • Verify protein integrity using SDS-PAGE and Western blotting

    • Confirm cofactor incorporation through UV-visible spectroscopy (FAD absorption at ~450 nm, heme at ~410 nm)

    • Assess protein homogeneity using analytical size exclusion chromatography

    • Perform mass spectrometry to confirm the absence of truncations or modifications

  • Cofactor-related variables:

    • Test FAD diffusibility: Since FAD reduced by STEAP2 can be utilized by STEAP1 , inconsistent results may arise from variable FAD association

    • Standardize FAD:protein ratios in experimental setups

    • Consider heme incorporation efficiency, which can vary between preparations

    • Validate NADPH quality and concentration standardization

  • Experimental condition optimization:

    VariableRecommended RangeOptimization Method
    pH6.5-7.5Test at 0.5 pH unit intervals
    Ionic strength50-200 mM NaClTitration series
    Temperature25-37°CControl and monitor precisely
    Reducing agents0-2 mM DTT/TCEPTest impact on background
    Detergent CMC>2x CMCEnsure above critical micelle concentration
  • Metal substrate considerations:

    • Note that STEAP2 reduces ferric nitrilotriacetic acid (Fe³⁺-NTA) significantly slower than STEAP1

    • Consider that the highly flexible extracellular region in STEAP2 may affect metal binding

    • Standardize metal:chelator ratios in substrate preparation

    • Control for metal contamination in buffers and reagents

  • Membrane environment factors:

    • For membrane-reconstituted systems, standardize lipid composition

    • Control protein:lipid ratios in reconstitution procedures

    • Verify proper orientation in proteoliposomes or nanodiscs

    • Consider detergent effects on enzyme activity if working with solubilized protein

  • Measurement system validation:

    • Implement positive controls with known metalloreductases

    • Develop standard curves for each experimental setup

    • Use multiple detection methods to cross-validate observations

    • Perform time-course experiments to ensure linearity of reaction rates

  • Data analysis approaches:

    • Apply appropriate statistical tests for reproducibility assessment

    • Consider Bayesian analysis for handling variability in biological systems

    • Implement outlier detection strategies

    • Normalize data to internal standards when possible

  • Cross-laboratory validation:

    • Exchange protocols and key reagents with collaborating laboratories

    • Standardize reporting of experimental conditions

    • Consider round-robin testing for critical observations

    • Implement blinded analysis where appropriate5

When troubleshooting, researchers should particularly focus on the specific observation that FAD is diffusible rather than staying tightly bound to STEAP2 , as this feature may contribute significantly to variability in electron transfer experiments if not properly controlled.

What are the most promising emerging techniques for studying STEAP2 function and regulation?

The study of STEAP2 function and regulation is advancing through several promising emerging techniques:

  • Cryo-electron microscopy (cryo-EM) for structural dynamics:

    • Building on the successful 3.2 Å resolution structure of human STEAP2 with NADP+ and FAD

    • Time-resolved cryo-EM to capture conformational changes during the electron transfer process

    • Single-particle analysis of STEAP2 in different functional states

  • Advanced genetic engineering approaches:

    • CRISPR/Cas9-mediated knock-in of fluorescent or affinity tags at endogenous loci

    • Base editing for introducing specific mutations to study structure-function relationships

    • Conditional knockout systems for tissue-specific and temporal control of STEAP2 expression

  • Live-cell imaging techniques:

    • FRET-based biosensors to monitor STEAP2 interactions with binding partners

    • Super-resolution microscopy to visualize STEAP2 localization in the trans-Golgi network and plasma membrane

    • Single-molecule tracking to follow STEAP2 trafficking in real-time

  • Proteomics approaches:

    • Proximity labeling (BioID, APEX) to identify STEAP2 protein interaction networks

    • Quantitative phosphoproteomics to map STEAP2 regulation by post-translational modifications

    • Crosslinking mass spectrometry to capture transient protein-protein interactions

  • Advanced functional assays:

    • Development of genetically-encoded metal sensors for real-time monitoring of STEAP2 activity

    • Microfluidic systems for high-throughput analysis of STEAP2 variants

    • Organ-on-chip technologies to study STEAP2 function in physiologically relevant microenvironments

  • Computational approaches:

    • Molecular dynamics simulations to study electron transfer mechanisms

    • Machine learning for predicting STEAP2 interaction partners and regulatory networks

    • Systems biology approaches to integrate STEAP2 into cellular metabolic models

  • Organoid and in vivo imaging technologies:

    • Patient-derived organoids for studying STEAP2 in disease-relevant contexts

    • Intravital microscopy to visualize STEAP2-mediated processes in live animals

    • PET imaging with STEAP2-targeted tracers for non-invasive monitoring in animal models

These emerging techniques offer unprecedented opportunities to unravel the complex functions of STEAP2 in normal physiology and disease states, particularly in cancer progression where STEAP2 has been implicated in promoting EMT through the PI3K/AKT/mTOR axis .

What are the most critical unanswered questions about mouse STEAP2 that warrant further investigation?

Despite significant advances in our understanding of STEAP2, several critical questions remain unanswered, particularly regarding mouse STEAP2:

  • Physiological substrate specificity:

    • What are the primary physiological metal substrates of mouse STEAP2 in vivo?

    • How does substrate preference differ between mouse and human STEAP2?

    • Is the reduced activity toward Fe³⁺-NTA compared to STEAP1 observed in human STEAP2 also present in mouse STEAP2?

  • Regulatory mechanisms:

    • How is mouse STEAP2 expression and activity regulated in different tissues?

    • What signaling pathways beyond PI3K/AKT/mTOR interact with STEAP2?

    • What role do post-translational modifications play in STEAP2 regulation?

  • Developmental and tissue-specific functions:

    • What is the precise role of STEAP2 in normal mouse development?

    • How does STEAP2 function differ across various mouse tissues?

    • What compensatory mechanisms exist when STEAP2 is deficient?

  • Differential FAD binding dynamics:

    • Is the diffusible nature of FAD observed in human STEAP2 conserved in mouse STEAP2?

    • What structural features determine FAD binding affinity?

    • How does FAD exchange between STEAP family members occur in vivo?

  • Cancer progression mechanisms:

    • What are the downstream targets of STEAP2 in promoting EMT in mouse cancer models?

    • How does STEAP2 interact with EFEMP2 at the molecular level in mouse osteosarcoma?

    • Are there cancer type-specific functions of STEAP2?

  • Structural comparisons:

    • How does the structure of mouse STEAP2 compare to the 3.2 Å resolution structure of human STEAP2?

    • What structural features account for potential functional differences between mouse and human STEAP2?

    • How do membrane environments affect STEAP2 structure and function?

  • Therapeutic targeting specificity:

    • Can mouse models accurately predict the efficacy and safety of STEAP2-targeted therapies for human cancers?

    • What are the consequences of long-term STEAP2 inhibition in mouse models?

    • How does targeting STEAP2 affect other STEAP family members due to potential compensatory mechanisms?

  • Evolution and comparative biology:

    • How has STEAP2 function evolved across species?

    • What functional adaptations exist in mouse STEAP2 compared to other mammals?

    • Are there species-specific interaction partners that modify STEAP2 function?

Addressing these questions will require interdisciplinary approaches combining structural biology, biochemistry, cell biology, and in vivo models. Particularly important will be the development of mouse-specific tools and reagents to study STEAP2 function in physiologically relevant contexts, and comparative studies between mouse and human STEAP2 to understand species-specific differences that may impact translational research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.