Recombinant Mouse Metalloreductase STEAP3 (Steap3)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant Mouse STEAP3 is produced using diverse expression systems. Below is a comparative table of production methods:

Expression SystemHostTagPurityApplicationSource
E. coliBacteriaHis>90%Functional assays, WB, ELISA
HEK-293Mammalian cellsMyc-DYKDDDDK>80%Structural studies, signaling
Cell-free synthesisN/AStrep70-80%High-throughput screening

Purification involves affinity chromatography (e.g., Strep-Tactin for Strep tags). The protein is stored in lyophilized form at -80°C with Tris/PBS buffers and stabilizers like trehalose .

Functional Roles and Mechanisms

STEAP3 functions as a ferric-chelate and cupric reductase, critical for cellular iron uptake and copper metabolism. Key mechanisms include:

  • Iron homeostasis: Reduces endosomal Fe³⁺ to Fe²⁺ for transport into the cytosol, essential for erythroid cells and macrophages .

  • Copper reduction: Converts Cu²⁺ to Cu¹⁺, influencing copper-dependent enzymatic processes .

  • Signaling modulation: Interacts with TAK1 to regulate JNK/p38 pathways in hepatic steatosis and inflammation .

Functional data:

  • STEAP3-deficient macrophages show 60–70% reduced ferrireductase activity and impaired TLR4-mediated cytokine production (e.g., interferon-β) .

  • Overexpression in hepatocytes increases lipid accumulation by 40% in NAFLD models via TAK1 activation .

Role in Iron Metabolism

  • STEAP3 is the dominant ferrireductase in macrophages, with mRNA levels >200-fold higher than other STEAP family members . Knockout mice exhibit microcytic anemia and abnormal hepatic iron sequestration during inflammation .

Disease Associations

  • NAFLD/NASH: STEAP3 deletion reduces lipid deposition by 50% in hepatocytes and improves glucose metabolism .

  • Cancer: STEAP3 overexpression in colorectal cancer stabilizes β-catenin via Wnt signaling, promoting tumor progression . Conversely, its downregulation in hepatocellular carcinoma correlates with poor prognosis .

Immune Regulation

  • STEAP3 coordinates iron homeostasis and TLR4-mediated inflammatory responses. Depletion reduces interferon-β and chemokine production by 30–40% in macrophages .

Applications in Research

Recombinant Mouse STEAP3 is used in:

  • Functional assays: Measuring ferrireductase activity using NADPH-dependent Fe³⁺/Cu²⁺ reduction .

  • Disease modeling: Studying NAFLD, cancer, and anemia via in vitro overexpression or knockdown .

  • Therapeutic development: Screening inhibitors for STEAP3-mediated signaling pathways .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have a specific format preference, please indicate your requirement in the order notes. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery times, please consult your local distributor.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself. Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized formulations have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Steap3; Tsap6; Metalloreductase STEAP3; Dudulin-2; Protein nm1054; Six-transmembrane epithelial antigen of prostate 3; Tumor suppressor-activated pathway protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-488
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MSGEMDKPLISRRLVDSDGSLAEVPKEAPKVGILGSGDFARSLATRLVGSGFSVVVGSRN PKRTAGLFPSLAQVTFQEEAVSSPEVIFVAVFREHYSSLCSLADQLAGKILVDVSNPTEK EHLQHRQSNAEYLASLFPACTVVKAFNVISAWALQAGPRDGNRQVLICSDQPEAKRTISE MARAMGFTPLDMGSLASAREVEAIPLRLLPSWKVPTLLALGLFVCFYTYNFIRDVLQPYI RKDENKFYKMPLSVVNTTLPCVAYVLLSLVYLPGVLAAALQLRRGTKYQRFPDWLDHWLQ HRKQIGLLSFFFAMLHALYSFCLPLRRSHRYDLVNLAVKQVLANKSRLWVEEEVWRMEIY LSLGVLALGMLSLLAVTSLPSIANSLNWKEFSFVQSTLGFVALILSTMHTLTYGWTRAFE ENHYKFYLPPTFTLTLLLPCVIILAKGLFLLPCLSRRLTKIRRGWEKDGAVKFMLPGDHT QGEKTSHV
Uniprot No.

Target Background

Function
Metalloreductase STEAP3 (Steap3) is an endosomal ferrireductase crucial for efficient transferrin-dependent iron uptake in erythroid cells. It plays a role in erythroid iron homeostasis by reducing Fe(3+) to Fe(2+). Steap3 also mediates the reduction of Cu(2+) to Cu(1+), suggesting its involvement in copper homeostasis. It uses NADP(+) as an electron acceptor. Steap3 may function downstream of p53/TP53 to connect apoptosis and cell cycle progression. Furthermore, it is indirectly involved in exosome secretion by facilitating the secretion of proteins such as TCTP.
Gene References Into Functions
  1. TSAP6 deficiency leads to abnormal erythroid maturation and microcytic anemia. PMID: 25515317
  2. Steap3 deficiency results in abnormal iron status and homeostasis, leading to impaired TLR4-mediated inflammatory responses in macrophages. PMID: 22689674
  3. Studies show that STEAP3/TSAP6 is absent in mouse embryo fibroblasts derived from STEAP3/TSAP6 knockout mice (MEFs KO), but present in wild type MEFs. PMID: 22031863
  4. TSAP6 may enhance Myt1 activity and act downstream to p53, connecting apoptosis and cell-cycle progression. PMID: 12606722
  5. The DNA damage-induced p53-dependent nonclassical exosomal secretory pathway is impaired in TSAP6-null cells. PMID: 18617898
  6. A Y228H substitution in the ferrireductase Steap3 (Steap3(Y288H)) results in hypochromic microcytic anemia. PMID: 18955558

Show More

Hide All

Database Links
Protein Families
STEAP family
Subcellular Location
Endosome membrane; Multi-pass membrane protein.
Tissue Specificity
Highly expressed in fetal liver (the site of midgestational hematopoiesis).

Q&A

What is STEAP3 and what are its primary functions in murine physiology?

STEAP3 (Six-Transmembrane Epithelial Antigen of Prostate 3) is a metalloreductase that functions primarily as a ferrireductase, reducing Fe³⁺ to Fe²⁺. It plays a vital role in erythropoiesis by facilitating iron reduction, which allows Fe²⁺ to be loaded into the heme pocket during red blood cell (RBC) development . STEAP3 was first identified in 2005 through analysis of a mutant mouse strain (nm1054) with hypochromic microcytic anemia, establishing its critical role in iron metabolism and erythroid development . Beyond its role in iron reduction, STEAP3 can also act on copper, potentially affecting RBC redox biology through multiple pathways .

How conserved is STEAP3 between mice and humans?

Murine and human STEAP3 share approximately 85% identity at the amino acid level, suggesting a high degree of functional conservation across species . This conservation is further supported by clinical observations of human families with genetic STEAP3 deficiencies who present with anemia resembling that observed in STEAP3 knockout mice . The significant homology between species makes mouse STEAP3 a valuable model for studying potential human applications and disease relevance.

What are the available forms of recombinant mouse STEAP3 for research applications?

Recombinant mouse STEAP3 is available in several research-ready formats, including pre-coupled magnetic beads. These preparations typically feature the protein derived from HEK293 expression systems with defined characteristics such as particle size (~2 μm), hydrophilic surface properties, and binding capacity (>200 pmol rabbit IgG/mg beads) . Researchers should store these preparations at 2-8°C without freezing to maintain stability, which typically extends at least 6 months under proper storage conditions .

How can STEAP3 activity be accurately measured in experimental settings?

STEAP3 ferrireductase activity can be quantified using the chemical 3-(2-pyridyl)-5,6-diphenyl-1,2,4-triazine-p,p′-disulfonic acid (ferrozine) and measuring changes in absorbance at 562 nm . A standard experimental protocol involves:

  • Sample preparation: Isolate RBC ghosts (membranes) using established protocols

  • Reaction setup: Combine sample with ferrozine reagent in appropriate buffer

  • Activity measurement: Monitor absorbance changes at 562 nm over time

  • Data analysis: Calculate reaction rates relative to controls

This spectrophotometric approach provides a reliable quantitative assessment of STEAP3 ferrireductase functionality that can be standardized across experimental conditions .

What are optimal approaches for detecting STEAP3 protein expression in mouse tissues?

STEAP3 protein expression can be reliably detected through western blot analysis using commercially available antibodies. An effective protocol includes:

  • Sample preparation: Isolate RBC ghosts (membranes) using established protocols

  • Protein separation: Perform SDS-PAGE under reducing conditions

  • Transfer and blocking: Transfer proteins to appropriate membrane and block non-specific binding

  • Primary antibody: Incubate with rabbit anti-STEAP3 polyclonal antibody (e.g., Proteintech #17186-1-AP)

  • Detection: Use appropriate secondary antibody and detection system

  • Controls: Include anti-actin (e.g., Cell Signaling Technology #4970) as loading control

For accurate quantitative comparisons between samples, researchers should normalize STEAP3 band intensity to actin or another housekeeping protein .

What applications can pre-coupled magnetic beads with recombinant mouse STEAP3 support?

Pre-coupled magnetic beads with recombinant mouse STEAP3 enable multiple research applications including:

  • Immunoassay development for STEAP3-interacting proteins

  • In vitro diagnostics to assess STEAP3-related pathways

  • Cell sorting of populations expressing STEAP3 receptors

  • Immunoprecipitation/co-precipitation to identify protein complexes

  • Protein/antibody separation and purification

These applications benefit from the uniform particle size and narrow size distribution of the beads, which provide large surface area for efficient target molecule capture with high specificity . The system is compatible with automation equipment for high-throughput operations, making it suitable for large-scale experimental designs.

How does STEAP3 expression impact red blood cell storage and transfusion outcomes?

Increased STEAP3 expression negatively impacts RBC storage quality and post-transfusion recovery in a dose-dependent manner . Research has established that:

  • Mouse strains with high STEAP3 expression (e.g., FVB) show poor RBC storage characteristics

  • Strains with low STEAP3 expression (e.g., B6, BALB/cByJ, BTBR) demonstrate superior RBC storage

  • Transgenic mice with artificially increased STEAP3 expression on a B6 background show decreased post-transfusion RBC recovery

  • The mechanism involves increased oxidative stress and lipid peroxidation in stored RBCs

The causal relationship was confirmed through multiple experimental approaches including genetic mapping (QTL and congenic mapping), protein expression analysis, and transgenic mouse models where STEAP3 expression was the only variable . This research has significant implications for understanding donor variability in human blood banking.

What metabolic changes are associated with differential STEAP3 expression in RBCs?

Metabolomic analysis reveals substantial metabolic alterations associated with STEAP3 expression levels in RBCs. Principal component analysis of 59,867 different analytes showed that:

  • RBCs from mouse strains with high STEAP3 expression cluster separately from those with low expression

  • Transgenic mice with isolated increased STEAP3 expression show metabolic profiles trending toward high-STEAP3 expressing strains

  • These metabolic changes are specific to STEAP3 expression rather than artifacts of the transgenic process

  • Principal component 1 accounts for approximately 35% of the variability across samples

The metabolic signature includes changes in redox biology and lipid metabolism, with specific alterations in oxylipins generation that are directly attributable to STEAP3 expression levels . These findings establish STEAP3 as a key regulator of RBC metabolism with potential implications for numerous disease states involving oxidative stress.

What is the relationship between STEAP3 expression and in vivo RBC lifespan?

Interestingly, despite its significant impact on in vitro RBC storage, increased STEAP3 expression does not necessarily shorten in vivo RBC lifespan under baseline conditions . Experimental evidence shows:

These findings indicate that the relationship between STEAP3 expression and RBC biology is context-dependent, with different mechanisms potentially governing in vitro storage stability versus in vivo circulatory lifespan . Future research should investigate whether physiological oxidative stress might alter this relationship.

What are common pitfalls in quantitative trait loci (QTL) analysis for STEAP3-related phenotypes?

When conducting QTL analysis for STEAP3-related phenotypes, researchers should consider several potential challenges:

  • Multiple testing concerns: Apply appropriate statistical corrections (e.g., false discovery rate with q-value methods) with a threshold of q = 0.05 to minimize false associations

  • Model selection: Use appropriate linear models that account for the specific genetic structure of your cross (e.g., F2 intercross)

  • SNP selection: Ensure adequate coverage of the chromosome 1 region containing the Steap3 gene

  • Phenotype definition: Clearly define and consistently measure the STEAP3-related phenotype across all samples

For analyzing QTL data, the "lm" function in R can be used to create simple linear models and extract p-values associated with the F test, followed by plotting results on a -log10 P scale across the genome .

How can researchers effectively design transgenic models to isolate STEAP3 effects?

Designing transgenic models to isolate STEAP3 effects requires careful consideration of several factors:

  • Expression system selection: Use RBC-specific regulatory elements (e.g., LCB expression cassette) to target STEAP3 expression to the relevant cell type

  • Background strain selection: Choose a strain with low endogenous STEAP3 expression (e.g., B6) to clearly observe the effects of transgenic expression

  • Control development: Generate control transgenic lines expressing unrelated proteins from the same expression cassette (e.g., Kel-2N) to control for non-specific effects

  • Expression level verification: Confirm transgenic STEAP3 expression through both protein quantification and functional assays (ferrireductase activity)

This approach has successfully demonstrated that increased STEAP3 expression alone is sufficient to cause decreased 24-hour recovery of stored RBCs in a dose-dependent manner .

What considerations are important when interpreting STEAP3 protein data from western blots?

When interpreting STEAP3 protein data from western blots, researchers should consider:

  • Mobility variations: Transgenic STEAP3 protein may display different mobility compared to natural STEAP3, despite maintaining functional activity

  • Detection sensitivity: STEAP3 may be barely detectable in strains with low expression (e.g., B6, BALB/cByJ, BTBR) while clearly visible in high-expression strains

  • Quantification approach: Normalize band intensity to loading controls and include samples with known STEAP3 expression levels as references

  • Correlation with activity: Verify that protein levels correlate with ferrireductase activity measurements for functional validation

These considerations help ensure accurate interpretation of STEAP3 protein expression data and its relationship to functional outcomes in experimental systems .

How might STEAP3 expression variability in humans impact blood banking practices?

Based on current understanding of STEAP3 biology, several important research questions emerge regarding human applications:

  • Human donor variability: Human STEAP3 mRNA expression has been observed to vary up to threefold among healthy individuals, suggesting potential variation among blood donors

  • Storage quality prediction: RBCs from humans with moderately decreased STEAP3 function may demonstrate superior storage compared to RBCs from donors with full STEAP3 activity

  • Screening development: Since humans with heterozygous loss of function STEAP3 variants have normal baseline hematologic parameters, current routine RBC donor screening would not detect STEAP3 differences

  • Clinical significance: The impact of STEAP3 variation on transfusion outcomes in different patient populations requires investigation

These questions highlight the potential for STEAP3 as a biomarker for donor selection and blood unit quality prediction in transfusion medicine .

What role might STEAP3 play in disease states involving oxidative stress?

Beyond transfusion medicine, STEAP3's role in RBC redox biology suggests potential involvement in various disease states:

  • RBC storage can be viewed as a form of experimental oxidative stress that models other stressors RBCs encounter in health and disease

  • STEAP3 expression may influence RBC responses to oxidative stress in conditions such as:

    • Hemoglobinopathies (sickle cell disease, thalassemias)

    • Malaria and other infectious diseases affecting RBCs

    • Inflammatory conditions with increased oxidative burden

    • Metabolic disorders affecting redox homeostasis

  • The dual role of STEAP3 in both iron and copper metabolism positions it at the intersection of multiple redox-active pathways

Future research should explore how STEAP3 expression and activity modulation might serve as a therapeutic target in these various disease contexts .

How can advanced omics approaches further elucidate STEAP3 biology?

Advanced omics approaches offer numerous opportunities to expand our understanding of STEAP3 biology:

  • Untargeted metabolomics: Building on current findings showing distinctive metabolic signatures associated with STEAP3 expression levels

  • Proteomics: Identifying STEAP3 interacting partners and how they vary across cell types and disease states

  • Transcriptomics: Exploring gene expression networks regulated by or regulating STEAP3 expression

  • Genomics: Comprehensive analysis of genetic variants affecting STEAP3 expression or function across populations

  • Integration of multi-omics data: Combining these approaches to build comprehensive models of STEAP3's role in cellular physiology

These approaches can reveal new connections between STEAP3 and cellular processes beyond its established role in iron metabolism and RBC biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.