Recombinant Mouse Microsomal glutathione S-transferase 1 (Mgst1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize development of the specified tag.
Synonyms
Mgst1; Microsomal glutathione S-transferase 1; Microsomal GST-1; Microsomal GST-I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-155
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Mgst1
Target Protein Sequence
ADLRQLMDNEVLMAFTSYATIILTKMMFMSSATAFQRITNKVFANPEDCAGFGKGENAKK FVRTDEKVERVRRAHLNDLENIVPFLGIGLLYSLSGPDLSTALMHFRIFVGARIYHTIAY LTPLPQPNRGLAFFVGYGVTLSMAYRLLRSRLYL
Uniprot No.

Target Background

Function
Conjugation of reduced glutathione to a wide range of exogenous and endogenous hydrophobic electrophiles.
Gene References Into Functions
  1. MGST1's impact on hematopoiesis has been demonstrated in hematopoietic stem/progenitor cells (HSPC) isolated from mice, where it is expressed at high levels. Lentiviral shRNA MGST1 knockdown significantly reduced the differentiation of dedicated hematopoietic cells upon promoting HSPC differentiation. PMID: 29702404
  2. This research identified the promoter region of MGST1 and conducted a comprehensive examination of its tissue expression. PMID: 15157743
  3. MGST1 is a dominant and highly expressed enzyme in mouse retinal pigment epithelium (RPE) microsomes. It plays a crucial protective role against oxidative insult in the RPE, a role that diminishes with age. PMID: 15641772
  4. Gst genes are extensively downregulated in primary, but not metastatic, TRAMP tumors. PMID: 19444856
Database Links
Protein Families
MAPEG family
Subcellular Location
Microsome. Mitochondrion outer membrane; Peripheral membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is mouse MGST1 and what are its key structural characteristics?

Microsomal glutathione S-transferase 1 (MGST1) is a membrane-bound enzyme that belongs to the glutathione S-transferase family. Mouse MGST1 consists of 155 amino acids with a calculated molecular mass of approximately 17.5 kDa . The full-length protein contains an uncleaved transit peptide at its N-terminus that facilitates mitochondrial localization. The functional MGST1 protein typically exists as a homodimer and is primarily localized in the membrane fraction of cells, particularly in microsomes .

When recombinantly expressed in bacterial systems such as E. coli, MGST1 retains its membrane localization property, which is critical for its catalytic function . The protein's structure enables it to interact with both hydrophobic substrates and reduced glutathione, facilitating conjugation reactions that are essential for cellular detoxification processes.

How is recombinant mouse MGST1 typically produced and purified?

Recombinant mouse MGST1 is typically produced using prokaryotic expression systems, predominantly E. coli. The production process begins with isolating the full-length cDNA encoding MGST1 from mouse liver tissue using RT-PCR . Researchers design primers based on published cDNA sequences, often incorporating restriction enzyme sites (such as 5' NdeI and 3' HindIII) to facilitate directional cloning into bacterial expression vectors like pSP19T7LT .

The expression protocol typically involves:

  • Transformation of the expression construct into a bacterial strain such as BL21(DE3)

  • Induction of protein expression using IPTG (typically 1 mM) at moderate temperatures (around 30°C) to enhance proper folding

  • Harvesting bacterial cells and disruption to isolate the membrane fraction

  • Purification using affinity chromatography, typically leveraging His-tag or GST-tag fusion constructs

The recombinant protein is often verified through:

  • SDS-PAGE analysis to confirm molecular weight

  • Western blot using anti-MGST1 antibodies

  • Enzymatic activity assays using substrates like CDNB (1-chloro-2,4-dinitrobenzene) or cumene hydroperoxide

What are the optimal storage conditions for maintaining MGST1 stability?

Proper storage of recombinant MGST1 is crucial for maintaining its stability and enzymatic activity. Based on manufacturer recommendations and research protocols, the following storage guidelines should be followed:

For short-term storage (up to one month), recombinant MGST1 can be stored at 2-8°C in appropriate buffer systems . For long-term storage, the protein should be:

  • Aliquoted into small volumes to avoid repeated freeze-thaw cycles

  • Stored at -80°C for optimal preservation of activity (up to 12 months)

  • Reconstituted in 10mM PBS (pH 7.4) to a concentration of 0.1-1.0 mg/mL prior to use

  • Not subjected to vortexing, which can compromise protein integrity

The thermal stability of MGST1 can be assessed through accelerated thermal degradation tests. These tests typically involve incubating the protein at 37°C for 48 hours and monitoring for degradation or precipitation . Research shows that the addition of stabilizing agents such as trehalose (5%) can enhance MGST1 stability during freeze-drying and subsequent storage.

How does MGST1 contribute to melanin biosynthesis pathways?

Recent research has revealed a previously unrecognized role for MGST1 in melanin biosynthesis pathways. MGST1 has been identified as a key contributor to eumelanin synthesis through its involvement in dopachrome formation . The enzymatic mechanism appears to involve the following processes:

  • MGST1 catalyzes the cyclization of dopaquinone intermediates, enhancing dopachrome formation even in the presence of high GSH concentrations (5 mM)

  • The catalytic activity of MGST1 is essential for this function, as demonstrated by experiments with catalytically inactivated controls

  • In melanocytic cells, MGST1 knockdown significantly reduces dopachrome formation, indicating its direct role in melanogenesis

Experiments have shown that dopachrome formation correlates linearly with MGST1 levels in both melanotic and amelanotic melanoma cells . When L-dopa is used as an initial substrate, dopaquinone can be formed either through tyrosinase activity (in cellular lysates) or through L-dopa oxidation. MGST1 then catalyzes the conversion of dopaquinone to dopachrome, promoting eumelanin synthesis .

In overnight incubation experiments, purified recombinant MGST1 dramatically increased eumelanin production from L-dopa in a concentration-dependent manner, providing further evidence of its direct catalytic role in melanogenesis .

What methodologies are most effective for assessing MGST1 enzymatic activity?

Several methodologies have been established for assessing the enzymatic activity of recombinant MGST1, each providing insights into different aspects of its functionality:

1. Glutathione conjugation assays:

  • Using 1-chloro-2,4-dinitrobenzene (CDNB) as a substrate to measure GSH conjugation activity

  • Spectrophotometric monitoring of the reaction at 340 nm

  • Conversion rates can be calculated using the extinction coefficient of the GS-DNB conjugate

2. Peroxidase activity assays:

  • Using cumene hydroperoxide as a substrate

  • Measuring GSH oxidation rates

  • This assay is particularly relevant for assessing MGST1's role in protection against oxidative stress

3. Dopachrome formation assay:

  • Using L-dopa as an initial substrate

  • Measuring dopachrome formation spectrophotometrically

  • Comparing reaction rates with and without MGST1 to determine catalytic enhancement

  • Including GSH (5 mM) to assess competition between glutathionylation and cyclization pathways

4. Eumelanin quantification:

  • Overnight incubation of L-dopa with recombinant MGST1

  • Measurement of eumelanin pigment formation at various L-dopa concentrations

  • Quantitative assessment of how MGST1 concentration affects pigment production

A comprehensive assessment should include controls such as heat-inactivated enzyme and reactions without enzyme to distinguish between enzymatic and non-enzymatic conversions.

How does MGST1 knockdown affect cellular metabolism and tumor progression?

Knockdown of MGST1 in melanoma cells results in profound metabolic and functional changes that impact tumor progression. Metabolomic analyses reveal distinct metabolic signatures in MGST1 knockdown cells compared to controls :

Metabolic PathwayEffect of MGST1 Knockdown
Pentose Phosphate PathwayDecreased metabolite levels
Tricarboxylic Acid CycleDecreased metabolite levels
GlycolysisDecreased metabolite levels
Amino Acid MetabolismDecreased metabolite levels
Glycerophospholipid MetabolismDecreased metabolite levels

These metabolic alterations collectively contribute to a distinct energy phenotype in MGST1 knockdown cells. Notably, cellular ATP levels are significantly reduced in both B16 and MNT-1 melanoma cell lines following MGST1 knockdown .

Beyond metabolic changes, MGST1 knockdown induces several phenotypic alterations with implications for tumor progression:

  • Morphological changes in melanoma cells

  • Enhanced cytokine responses, including increased IFNγ and TNFα production

  • Increased Granzyme B expression, suggesting enhanced immune recognition

  • Reduced tumor-induced immunosuppression, potentially improving anti-tumor immune responses

These findings suggest that MGST1 not only contributes to melanin synthesis but also plays a significant role in sustaining the metabolic requirements of melanoma cells and modulating tumor-immune interactions .

What are the critical factors for successful expression of active recombinant mouse MGST1?

Successful expression of catalytically active recombinant mouse MGST1 requires careful consideration of several critical factors:

Expression system selection:

  • E. coli systems (particularly BL21(DE3)) have proven effective for producing functional MGST1

  • Proper vector design should include optimal promoter elements (such as T7) and appropriate fusion tags to aid purification and detection

Expression conditions optimization:

  • Induction with IPTG at moderate concentrations (typically 1 mM)

  • Lower temperature expression (30°C rather than 37°C) to enhance proper folding

  • Expression duration of 4-6 hours to balance yield and protein quality

Membrane localization considerations:

  • Recognition that MGST1 localizes to bacterial membranes when expressed

  • Appropriate cell disruption methods to preserve membrane integrity during initial processing

  • Extraction protocols that effectively solubilize membrane-associated MGST1 without denaturing it

Quality control measures:

  • Confirmation of molecular weight via SDS-PAGE (expected size approximately 17.5 kDa for the native protein, plus any fusion tags)

  • Western blot analysis using specific antibodies to verify protein identity

  • Activity assays with standard substrates to confirm functional expression

Researchers should be aware that membrane association is critical for MGST1 function, and strategies that increase soluble expression may compromise enzymatic activity if they disrupt membrane interactions.

How can researchers effectively study MGST1's role in disease models?

To effectively study MGST1's role in disease models, researchers should consider comprehensive experimental approaches that address multiple aspects of MGST1 function:

Genetic modulation strategies:

  • Knockdown approaches using shRNA lentiviral particles (as demonstrated in SK-Mel-28 cells)

  • Overexpression systems using lentiviral vectors (as in 1205Lu cells)

  • CRISPR/Cas9 gene editing for precise modification of the MGST1 gene

Functional assessment methods:

  • Melanin production quantification in melanoma models

  • Dopachrome formation assays to assess enzymatic contribution to melanogenesis

  • Metabolomic profiling to characterize broader metabolic impacts

In vivo model systems:

  • Mouse models with MGST1 knockdown or knockout to assess systemic effects

  • Zebrafish models for visual assessment of melanin pigmentation changes

  • Tumor xenograft studies to evaluate effects on tumor growth and immune interactions

Protein-protein interaction studies:

  • Investigation of whether MGST1 forms complexes with melanogenic enzymes

  • Assessment of potential chaperone functions

  • Determination of subcellular localization and co-localization with other proteins

Data from these complementary approaches should be integrated to develop a comprehensive understanding of MGST1's role in specific disease contexts. For melanoma studies, researchers should consider both the direct effects on melanin synthesis and the broader metabolic and immunological consequences of MGST1 modulation.

What are the common challenges in purifying active recombinant MGST1?

Purification of active recombinant MGST1 presents several technical challenges due to its membrane association and specific structural requirements for activity. Researchers commonly encounter the following issues:

Membrane association complexity:

  • MGST1 localizes to bacterial membranes when expressed in E. coli

  • Extraction requires detergents or membrane solubilization methods that can potentially compromise activity

  • Balance between effective extraction and preservation of native conformation is critical

Protein stability concerns:

  • Susceptibility to thermal degradation during purification procedures

  • Risk of activity loss during freeze-thaw cycles

  • Potential aggregation during concentration steps

Purification strategy limitations:

  • Tag interference with enzymatic activity

  • Incomplete removal of bacterial contaminants

  • Loss of quaternary structure during purification

To address these challenges, researchers have developed several effective solutions:

  • Use of mild, non-ionic detergents for membrane solubilization

  • Inclusion of glycerol (10-15%) in purification buffers to enhance stability

  • Addition of reduced glutathione during purification to protect catalytic sites

  • Implementation of affinity chromatography strategies using carefully positioned tags

  • Employment of accelerated thermal degradation tests to identify optimal stabilization conditions

Successful purification typically involves confirming activity at each purification step and careful optimization of buffer conditions to preserve the native conformation and catalytic functionality of MGST1.

How can researchers resolve data inconsistencies in MGST1 functional studies?

When encountering inconsistencies in MGST1 functional studies, researchers should systematically address potential sources of variation through a structured troubleshooting approach:

Protein quality assessment:

  • Verify protein integrity through SDS-PAGE and western blotting

  • Confirm catalytic activity using standard substrates (CDNB or cumene hydroperoxide)

  • Assess thermal stability under experimental conditions

Experimental condition standardization:

  • Control for buffer composition effects on activity

  • Standardize protein concentration determination methods

  • Maintain consistent temperature and pH across comparative experiments

Cell line and model system selection:

  • Consider inherent differences in MGST1 expression across cell lines

  • Assess the presence of compensatory mechanisms in knockout/knockdown models

  • Verify knockdown/overexpression efficiency in each experimental system

Technical considerations for specific assays:

  • For melanogenesis studies: Control for background melanin production and standardize L-dopa concentrations

  • For enzymatic assays: Account for competing non-enzymatic reactions

  • For metabolomic analyses: Implement rigorous sample preparation protocols and appropriate controls

Data inconsistencies can often be resolved by implementing parallel methodologies to measure the same endpoint. For example, MGST1's contribution to melanogenesis can be assessed through direct measurement of dopachrome formation, quantification of final melanin content, and evaluation of gene/protein expression of related enzymes in the melanogenic pathway .

What are emerging applications for recombinant mouse MGST1 in research?

Several promising research directions are emerging for recombinant mouse MGST1, expanding its utility beyond traditional enzymatic studies:

Therapeutic target exploration:

  • Development of specific MGST1 inhibitors for melanoma treatment

  • Investigation of MGST1 modulation to enhance immune recognition of tumors

  • Exploration of MGST1's potential as a target in combating drug resistance mechanisms

Biochemical probe development:

  • Utilization of recombinant MGST1 to study novel catalytic mechanisms

  • Development of MGST1-based biosensors for detecting xenobiotics

  • Creation of activity-based probes to monitor MGST1 function in living systems

Structural biology advancements:

  • Detailed characterization of MGST1's active site architecture

  • Investigation of the structural basis for MGST1's dual functionality in detoxification and melanogenesis

  • Exploration of protein-protein interactions that modulate MGST1 function

Metabolic regulation studies:

  • Further characterization of MGST1's role in cellular energy metabolism

  • Investigation of its potential involvement in redox homeostasis

  • Exploration of connections between MGST1 activity and mitochondrial function

These emerging applications highlight the expanding significance of recombinant MGST1 as both a research tool and a potential therapeutic target, particularly in the context of melanoma and other diseases characterized by oxidative stress and metabolic dysregulation.

How can advanced techniques enhance MGST1 research?

Integration of cutting-edge techniques can significantly advance MGST1 research, providing deeper insights into its diverse functions and regulatory mechanisms:

Cryo-electron microscopy:

  • High-resolution structural determination of MGST1 in its membrane environment

  • Visualization of substrate binding and catalytic intermediates

  • Characterization of conformational changes during catalysis

Single-molecule enzymology:

  • Real-time monitoring of individual MGST1 molecules during catalysis

  • Determination of reaction kinetics at unprecedented resolution

  • Identification of rare or transient catalytic states

Systems biology approaches:

  • Integration of proteomics, metabolomics, and transcriptomics data

  • Network analysis to uncover broader impacts of MGST1 modulation

  • Mathematical modeling of MGST1's role in melanogenesis and detoxification pathways

Advanced in vivo imaging:

  • Real-time visualization of melanin production in MGST1-modulated animal models

  • Tracking of metabolic changes associated with MGST1 activity

  • Monitoring of tumor-immune interactions influenced by MGST1 expression

These advanced techniques can overcome current limitations in MGST1 research, particularly in understanding the dynamic aspects of its function and its integration into broader cellular systems. By combining these approaches with traditional biochemical and cell biological methods, researchers can develop a more comprehensive understanding of MGST1's diverse roles in health and disease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.