Recombinant Mouse Mitochondrial 2-oxoglutarate/malate carrier protein (Slc25a11)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Metabolism

Slc25a11 is integral to multiple metabolic pathways:

  • Metabolite Transport:
    Exchanges 2-oxoglutarate for malate, succinate, or other dicarboxylic acids, enabling critical shuttles like:

    • Malate-aspartate shuttle (NADH transfer for oxidative phosphorylation)

    • Oxoglutarate/isocitrate shuttle (linking TCA cycle and cytosolic metabolism)

  • Energy Production:
    Supports ATP generation by transporting NADH-derived metabolites into mitochondria .

  • Mitochondrial Dynamics:
    Maintains cristae morphology and fusion/fission balance, influencing apoptosis .

  • Redox Regulation:
    Modulates mitochondrial glutathione levels to mitigate oxidative stress .

Mechanism of Action

  • ATP Depletion: Reduces mTOR signaling and protein synthesis, leading to cancer cell death .

  • Diagnostic Potential: Area under the ROC curve (AUC) = 0.635 for liver cancer detection .

Applications in Research

Recombinant Slc25a11 is utilized in:

  • Functional Assays: Measuring transport kinetics of 2-oxoglutarate/malate exchange .

  • Protein Interaction Studies: Partners include UQCRC1, NDUFS2, and CYC1 (components of electron transport chain complexes) .

  • Therapeutic Screening: Targeting Slc25a11 in cancer models to disrupt energy metabolism .

Limitations and Future Directions

  • Most functional data derive from human orthologs (SLC25A11), necessitating validation in mouse-specific systems.

  • Structural details of the partial recombinant mouse protein remain unspecified .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Slc25a11; Mitochondrial 2-oxoglutarate/malate carrier protein; OGCP; Solute carrier family 25 member 11
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-314
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Slc25a11
Target Protein Sequence
AATASPGAGRMDGKPRTSPKSVKFLFGGLAGMGATVFVQPLDLVKNRMQLSGEGAKTREY KTSFHALTSILKTEGLKGIYTGLSAGLLRQATYTTTRLGIYTVLFERLTGADGTPPGFLL KALIGMTAGATGAFVGTPAEVALIRMTADGRLPADQRRGYKNVFNALVRIAREEGVPTLW RGCIPTMARAVVVNAAQLASYSQSKQFLLDSGYFSDNILCHFCASMISGLVTTAASMPVD IVKTRIQNMRMIDGKPEYKNGLDVLLKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFLE QMNKAYKRLFLSG
Uniprot No.

Target Background

Function
This recombinant mouse mitochondrial 2-oxoglutarate/malate carrier protein (Slc25a11) catalyzes the electroneutral exchange of 2-oxoglutarate across the inner mitochondrial membrane for malate or other dicarboxylic acids. It plays a crucial role in various metabolic pathways, including the malate-aspartate shuttle, the oxoglutarate/isocitrate shuttle, gluconeogenesis from lactate, and nitrogen metabolism. Furthermore, it is involved in maintaining mitochondrial fusion and fission, cristae organization and morphology, and the regulation of apoptosis.
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the function of Slc25a11 in mitochondrial metabolism?

Slc25a11, also known as the oxoglutarate carrier (OGC), is a critical component of the malate/aspartate shuttle (MAS). This protein mediates the electroneutral exchange of 2-oxoglutarate (2-OG) from the mitochondrial matrix to the cytoplasm, with malate moving in the opposite direction . This transport function is essential for:

  • Maintaining redox balance between cytosolic and mitochondrial compartments

  • Supporting proper functioning of the tricarboxylic acid (TCA) cycle

  • Facilitating amino acid metabolism, particularly glutamate and aspartate

  • Enabling appropriate NADH transport across the mitochondrial membrane

The protein contains a PX[D/E]XX[K/R]X[K/R] signature sequence motif (PROSITE PS50920, PFAM PF00153) that is highly conserved across species, particularly within the SLC25 family of mitochondrial transporters .

How is Slc25a11 structurally characterized?

Slc25a11 belongs to the SLC25 family of mitochondrial carriers with characteristic structural features:

  • Contains the highly conserved PX[D/E]XX[K/R]X[K/R] signature sequence motif

  • The proline at position 239 is part of this critical motif

  • Mutagenesis studies of this proline residue in bovine OGC have demonstrated a severe defect in 2-OG transport activity

  • The protein contains alpha matrix helices that are critical for its carrier function

  • Structurally related to other mitochondrial carrier proteins essential for metabolite transport

What are the most effective methods for generating Slc25a11 knockout models?

CRISPR-Cas9 gene editing has emerged as the preferred method for generating Slc25a11 knockout models. Based on published protocols:

  • Design of targeted gRNA:

    • Use online tools such as http://crispr.genome-engineering.org/ for designing specific gRNAs

    • Target conserved functional regions of the gene

    • For mouse models, effective sgRNA sequences include 5'-ACTGCATCCGGTTCTTCACC-3′ and 5'-CGGATGCAGTTGAGTGGTGA-3′

  • Generating knockout cells:

    • Transfect cells with gRNA (0.6 μg) and Cas9 (2μg) plus YFP plasmids using appropriate transfection reagents (RNA i-MAX or Lipofectamine 2000)

    • Sort fluorescent cells using FACS for clonal selection

    • Screen clones by direct sequencing of the targeted sequence

  • Creating mouse knockouts:

    • Inject a mixture of Cas9 protein (100 ng/ul) and gRNA (50 ng/ul) into the cytoplasm of pronuclei

    • Generate sgRNAs using T7 in vitro transcription kit

    • Identify indel mutations in F1 mice after TA cloning and sequencing

    • Verify the absence of off-target mutations by sequencing predicted exonic off-target sequences

A sequential approach may be necessary to generate homozygous knockouts, with initial transfection generating heterozygous clones, followed by a second round to obtain homozygous mutants .

How can Slc25a11 protein expression be validated in experimental models?

Multiple validation techniques should be employed:

  • Immunohistochemistry (IHC):

    • Use specific anti-OGC antibodies on paraffin-embedded tissues

    • Include appropriate controls (wild-type tissues and other mutations)

    • Compare staining patterns between tumor cells and endothelial or sustentacular cells as internal controls

  • mRNA expression analysis:

    • Quantify Slc25a11 mRNA levels in tissues or leukocytes by RT-qPCR

    • Silent mutations may affect mRNA levels and can be detected through expression analysis

  • Loss of heterozygosity (LOH) assessment:

    • Compare germline and tumor DNA sequencing to identify LOH

    • LOH suggests a tumor-suppressor function of the gene

  • Functional validation:

    • Measure 2-OG transport activity in isolated mitochondria

    • Assess metabolomic changes in key metabolites (aspartate, glutamate, 2-OG)

    • Analyze NADH transport capacity across mitochondrial membranes

What metabolic alterations occur following Slc25a11 inactivation?

Slc25a11 inactivation leads to significant metabolic reprogramming:

  • Changes in key metabolites:

    • Marked increase in aspartate and glutamate levels

    • Decrease in 2-oxoglutarate (2-OG) levels

    • Altered 2-OG/succinate ratio

  • Redox imbalance:

    • Disruption of NADH/NAD+ ratio between cytosol and mitochondria

    • Compromised electron transport chain function

    • Altered oxidative phosphorylation capacity

  • Enzyme activity alterations:

    • Possible increased GOT2 (mitochondrial aspartate aminotransferase) activity

    • Inhibition of 2-OG-dependent enzymes including:

      • TET family DNA demethylases

      • JmjC-domain containing histone demethylases

      • HIF prolyl hydroxylases

These metabolic changes bear similarities to those observed in tumors with SDHx and FH mutations, suggesting a common pathway of metabolic disruption leading to tumorigenesis.

How does Slc25a11 deficiency contribute to the hypermethylator phenotype?

Slc25a11 deficiency leads to a characteristic hypermethylator phenotype affecting both DNA and histones:

  • DNA hypermethylation:

    • Reduced 5-hmC (5-hydroxymethylcytosine) immunolabelling in tumor cells compared to endothelial or sustentacular cells

    • Inhibition of TET family enzymes that require 2-OG as a cofactor

  • Histone modifications:

    • Positive H3K9me3 and H3K27me3 immunolabelling indicating histone hypermethylation

    • Inhibition of JmjC-domain containing histone demethylases

  • Mechanistic basis:

    • The altered 2-OG/succinate ratio inhibits 2-OG-dependent dioxygenases

    • Various derivatives of glutamate and aspartate (which accumulate) can be potent inhibitors of HIF prolyl hydroxylases

    • This mechanism is similar to that observed in SDHx- and FH-mutated paragangliomas

The hypermethylator phenotype is believed to contribute to tumorigenesis by altering gene expression patterns and cellular differentiation states.

How prevalent are Slc25a11 mutations in paraganglioma and pheochromocytoma?

Studies of large patient cohorts have revealed:

  • Mutation frequency:

    • Slc25a11 mutations account for approximately 1% of all PPGL cases

    • This frequency is comparable to other recently identified PPGL susceptibility genes (SDHA, TMEM127, MAX, FH)

  • Clinical characteristics:

    • In a cohort of 639 patients without mutations in major PPGL susceptibility genes, six patients with germline Slc25a11 mutations were identified

    • Five out of seven (71%) Slc25a11 mutation carriers developed malignant phenotypes

    • Slc25a11 mutations were found in 5% of all metastatic patients in the studied cohort

    • 17% of patients with single, apparently sporadic metastatic abdominal PGL carried Slc25a11 mutations

  • Mutation types identified:

    • 2 missense mutations

    • 2 frameshift mutations

    • 1 intronic mutation

    • 1 silent mutation (associated with decreased mRNA levels)

These findings establish Slc25a11 as a new genetic risk factor for metastatic PPGL, with implications for patient screening and follow-up.

What is the evidence for Slc25a11 functioning as a tumor suppressor gene?

Multiple lines of evidence support Slc25a11's role as a tumor suppressor:

  • Loss of heterozygosity (LOH):

    • Tumor DNA analysis showed LOH in all evaluable cases

    • This classic "two-hit" pattern is characteristic of tumor suppressor genes

  • Protein expression:

    • All evaluated tumors with Slc25a11 mutations showed negative OGC expression by immunohistochemistry

    • This contrasts with PPGL tumors without Slc25a11 mutations, which maintained OGC expression

  • Broader cancer implications:

    • Somatic mutations or copy-number alterations in Slc25a11 have been reported in various cancer types in The Cancer Genome Atlas (TCGA) and COSMIC databases

    • 33 of 145 cancer samples with Slc25a11 alterations showed underexpression of Slc25a11 mRNA

    • Low expression of Slc25a11 is associated with reduced survival in renal and pancreatic cancers

  • Experimental validation:

    • Slc25a11 knockout in cell models leads to metabolic alterations similar to those seen in human tumors

    • Blocking cytosolic NADH transportation into mitochondria by knockdown of MAS induces cancer cell death

How can Slc25a11 be targeted for therapeutic intervention in cancer?

Based on the understanding of Slc25a11's role in cancer, several therapeutic approaches show promise:

  • Targeting the hypermethylator phenotype:

    • Demethylating agents such as low-dosed 5-aza-deoxycytidine may provide therapeutic benefit

    • MGMT promoter methylation in Slc25a11-mutated tumors (as in SDHB-metastatic PPGL) may confer increased response to temozolomide

  • Antiangiogenic therapies:

    • Slc25a11-mutated tumors display pseudo-hypoxic phenotypes similar to SDHx and FH-mutated tumors

    • These tumors may respond to antiangiogenic treatments that target the HIF pathway

  • Metabolic targeting:

    • Interventions that exploit the altered metabolic state (increased glutamate/aspartate, decreased 2-OG)

    • Approaches that further disrupt the malate/aspartate shuttle in cancer cells lacking functional Slc25a11

  • Synthetic lethality approaches:

    • Identifying and targeting genes that become essential in the context of Slc25a11 deficiency

    • Exploiting vulnerabilities created by altered redox balance and mitochondrial dysfunction

What are the technical challenges in expressing and purifying functional recombinant Slc25a11?

Researchers face several challenges when working with recombinant Slc25a11:

  • Expression systems:

    • Bacterial systems often struggle with proper folding of mitochondrial membrane proteins

    • Eukaryotic expression systems (yeast, insect cells, mammalian cells) provide better folding but lower yields

    • Codon optimization may be necessary for efficient expression in heterologous systems

  • Purification considerations:

    • Detergent selection is critical for maintaining protein stability and function

    • Mild detergents like dodecyl maltoside are often suitable for mitochondrial carriers

    • Purification must be performed at 4°C to prevent protein degradation

  • Functional validation:

    • Transport activity assays require reconstitution into proteoliposomes

    • Radioactive or fluorescent 2-OG can be used to measure transport kinetics

    • Site-directed mutagenesis of key residues (such as Pro239) can serve as controls for functional studies

  • Complementation approaches:

    • Restoration of function can be achieved by transfecting Slc25a11-deficient cells with wild-type Slc25a11

    • Selection using antibiotics (e.g., Geneticin at 800 μg/mL) and cloning by limited dilution can isolate successfully complemented cells

What is the broader role of Slc25a11 in mitochondrial disease beyond cancer?

Current research suggests several important areas for future investigation:

  • Metabolic disorders:

    • Potential implications in conditions characterized by mitochondrial dysfunction

    • Possible role in neurodegenerative diseases with mitochondrial involvement

  • Developmental biology:

    • Understanding the role of Slc25a11 in embryonic development

    • Investigating tissue-specific functions in differentiated cells

  • Aging research:

    • Exploring how Slc25a11 function changes during aging

    • Potential role in age-related mitochondrial decline

  • Integration with other mitochondrial carriers:

    • Understanding the coordination between Slc25a11 and other components of the malate/aspartate shuttle

    • Investigating potential compensatory mechanisms when Slc25a11 is dysfunctional

How does Slc25a11 interact with the recently identified GOT2 pathway in paraganglioma?

Recent discoveries have revealed an intriguing connection between Slc25a11 and GOT2:

  • Functional relationship:

    • GOT2 encodes mitochondrial aspartate aminotransferase, which catalyzes the interconversion of aspartate and 2-OG to oxaloacetate and glutamate

    • A gain-of-function mutation in GOT2 was recently reported in a paraganglioma patient

  • Metabolic similarities:

    • Slc25a11-deficient cells show increased aspartate and glutamate levels

    • The aspartate/glutamate ratio is also increased in cases with GOT2 activating mutations

  • Proposed mechanism:

    • Slc25a11 deficiency may lead to increased GOT2 activity as a compensatory mechanism

    • This could lead to further alteration of the 2-OG/succinate ratio

    • The resulting inhibition of 2-OG dependent enzymes contributes to tumorigenesis

  • Research opportunities:

    • Investigating the interplay between Slc25a11 and GOT2 in malate-aspartate shuttle regulation

    • Exploring combined targeting of both pathways for therapeutic intervention

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.