Recombinant Mouse Mitochondrial brown fat uncoupling protein 1 (Ucp1)

Shipped with Ice Packs
In Stock

Description

Functional Mechanisms

Proton Transport

  • Acts as a fatty acid anion/H⁺ symporter: Long-chain fatty acids (LCFAs) bind Ucp1, enabling proton translocation while remaining anchored via hydrophobic tails .

  • Energy dissipation occurs via mitochondrial uncoupling, reducing membrane potential (Δψ) and ATP synthesis efficiency .

Regulation

  • Activation: Cold exposure or β-adrenergic signaling increases free fatty acids, which allosterically activate Ucp1 .

  • Inhibition: Purine nucleotides (ATP, GDP) bind to the cytosolic side, blocking proton leakage .

Research Applications

Thermogenesis Studies

  • Ucp1-KO mice exhibit cold intolerance and impaired BAT function, validating its role in adaptive thermogenesis .

  • Recombinant Ucp1 restores mitochondrial proton leak in vitro, rescuing thermogenic capacity in deficient models .

Metabolic Disease Models

  • Overexpression in white adipose tissue (WAT) induces browning, improving glucose tolerance and reducing obesity in mice .

  • Enhances ROS buffering by lowering mitochondrial membrane potential, mitigating ischemia-reperfusion injury in cardiac tissue .

Transcriptional Regulation

  • Cold exposure induces chromatin remodeling at distal enhancers (e.g., Ucp1-En4/En6), increasing promoter-enhancer interactions to upregulate expression .

  • Fibroblast growth factors (FGF6/9) bypass adipogenesis pathways to directly activate Ucp1 transcription via prostaglandin E2 signaling .

Experimental Insights

Purification Challenges

  • Traditional methods yielded unstable Ucp1 due to detergent and lipid removal. Covalent chromatography now enables isolation with retained cardiolipin, preserving activity .

Ligand Interactions

LigandEffect on Ucp1Stoichiometry
PalmitateActivates H⁺ conductance1:1
GTPInhibits proton leak1:1
Prostaglandin E2Indirect activation via FGF9/6N/A

Therapeutic Relevance

  • Obesity: Ucp1 activation increases energy expenditure, reducing adiposity in diet-induced obese mice .

  • Cardioprotection: Transgenic Ucp1 expression in heart mitochondria improves post-ischemic recovery by reducing oxidative stress .

  • Type 2 Diabetes: BAT activation via Ucp1 enhances systemic insulin sensitivity, shown in murine models .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please include them in your order notes. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery details.
Note: All proteins are shipped with standard blue ice packs unless otherwise specified. If dry ice shipping is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors including storage conditions, buffer composition, temperature, and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize development according to your requirements.
Synonyms
Ucp1; Slc25a7; Ucp; Mitochondrial brown fat uncoupling protein 1; UCP 1; Solute carrier family 25 member 7; Thermogenin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-307
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
VNPTTSEVQPTMGVKIFSAGVSACLADIITFPLDTAKVRLQIQGEGQASSTIRYKGVLGT ITTLAKTEGLPKLYSGLPAGIQRQISFASLRIGLYDSVQEYFSSGRETPASLGNKISAGL MTGGVAVFIGQPTEVVKVRMQAQSHLHGIKPRYTGTYNAYRVIATTESLSTLWKGTTPNL MRNVIINCTELVTYDLMKGALVNNKILADDVPCHLLSALVAGFCTTLLASPVDVVKTRFI NSLPGQYPSVPSCAMSMYTKEGPTAFFKGFVASFLRLGSWNVIMFVCFEQLKKELMKSRQ TVDCTT
Uniprot No.

Target Background

Function
Mitochondrial protein responsible for thermogenic respiration, a specialized capacity of brown adipose tissue and beige fat that participates in non-shivering adaptive thermogenesis in response to temperature and dietary variations. It also plays a role in the regulation of energy balance. Ucp1 functions as a long-chain fatty acid (LCFA) and proton symporter, simultaneously transporting one LCFA and one proton through the inner mitochondrial membrane. However, LCFAs remain associated with the transporter via their hydrophobic tails, resulting in an apparent transport of protons activated by LCFAs. This process dissipates the mitochondrial proton gradient and converts the energy of substrate oxidation into heat instead of ATP. Ucp1 also regulates the production of reactive oxygen species (ROS) by mitochondria.
Gene References Into Functions
  1. This study highlights the novel mechanism of HDAC3-regulated Ucp1 expression during beta-adrenergic receptor stimulation. PMID: 30126161
  2. These findings suggest that HDAC6 contributes to mitochondrial thermogenesis in brown adipose tissue by increasing UCP1 expression through cAMP-PKA signaling pathway. PMID: 29890133
  3. Findings demonstrated that one bout of both uphill and downhill exercise trainings as well as 8 weeks of training could increase the expression of PGC-1alpha and FNDC5 genes in the muscle tissues and the UCP1 gene in the subcutaneous adipose tissue. PMID: 30218749
  4. To identify putatively causal regulators, we performed transcription factor binding site overrepresentation analyses in active chromatin regions and prioritized factors based on their expression correlation with the bona-fide brown adipogenic marker Ucp1 across multiple mouse and human datasets. PMID: 28181539
  5. Pyruvate induces torpor in obese mice. Pyruvate does not induce torpor in lean mice but results in the activation of brown adipose tissue with an increase in the level of uncoupling protein-1. PMID: 29311303
  6. striking reduction of mitochondrial electron transport chain components in mice genetically lacking UCP1 PMID: 28630339
  7. UCP1 cannot be fully inhibited by all adenine nucleotides tested. Phosphate is a novel inhibitor of UCP3 and UCP1. Conserved arginines in the PN-binding pocket are involved in the inhibition of UCP1 and UCP3 to different extents. Fatty acids compete with all PNs bound to UCP1. PMID: 29212043
  8. UCP1 mRNA expression is increased significantly with 10 muM of ACTH. PMID: 28375845
  9. Data suggest that triiodothyronine and high glucose signal coordinately to up-regulate ChREBP, Ucp1, Glut4, and Fasn in brown adipocytes; ChREBP plays role as a central regulator of brown adipocyte activity/energy metabolism. (ChREBP = carbohydrate-responsive element-binding protein; Ucp1 = uncoupling protein-1; Glut4 = facilitated glucose transporter-4; Fasn = fatty acid synthase, type-I) PMID: 29077876
  10. expressed in tail sebaceous glands; data do not support a thermoregulatory role PMID: 26914475
  11. UCP1 expression under inflammation is mediated by the increased expression of DBC1, which inhibits SIRT1 activity. PMID: 28481291
  12. MKK6 acts as a repressor of UCP1 expression, suggesting that its inhibition promotes adipose tissue browning and increases organismal energy expenditure. PMID: 29021624
  13. we find that rapamycin inhibits mTORC1 but not mTORC2, leading to suppression of elevated lipolysis and restoration of thermogenic protein UCP1 levels, respectively PMID: 27926859
  14. mTORC1 mediated many of the beneficial actions of FGF21 in vitro, including UCP1 and FGF21 induction, increased adiponectin secretion, and enhanced glucose uptake without any adverse effects on insulin action. PMID: 27681418
  15. Thus UCP1-dependent diet-induced thermogenesis limits obesity development during exposure to obesogenic diets but does not prevent obesity as such PMID: 28679625
  16. This study demonstrated that elimination of the gene expressing uncoupling protein-1 (UCP1), the enzyme responsible for thermogenesis, prevented musculoskeletal hyperalgesia in response to either a swim or BRL37344. PMID: 27437788
  17. Aortic UCP1 content was greater in females than males and its deletion improved ex vivo aortic vasomotor function in females only. Constitutive UCP1 content in BAT was similar between females and males and loss of UCP1 did not abolish sex differences in insulin sensitivity. Metabolic disruptions caused by UCP1 ablation did not appear to be contingent upon increased oxidative stress in mice under normal dietary conditions. PMID: 28655717
  18. Gelidium elegans stimulates the expression of PRDM16 and UCP-1 Protein in brown adipose tissue and suppresses hyperglycemia in high-fat diet mice. PMID: 28358328
  19. through interaction with Zfp516, LSD1 is recruited to UCP1 and other brown adipose tissue-enriched genes. PMID: 27264172
  20. Together the data show that both UCP1 and UCP3 play essential and complementary roles in thermogenic responses in the mouse and suggest that UCP3-dependent thermogenesis is an under-appreciated mode of thermogenic energy dissipation. PMID: 27647490
  21. in vitro experiments show that Arrdc3-null adipocytes responded to beta-adrenergic receptor agonist with decreased Ucp1 levels PMID: 28291835
  22. Despite the absence of UCP1 in the majority of epididymal beige adipocytes, these cells employ prominent creatine cycling as a UCP1-independent thermogenic mechanism. PMID: 28380374
  23. These novel findings uncover a previously unrecognized metabolic protective role of UCP1 that is independent of its already established role in energy homeostasis/ PMID: 27881400
  24. human and rodent Brown adipose tissue have similar UCP1 function per mitochondrion. PMID: 27508873
  25. Targeted mitochondrial uncoupling in adipose tissue and skeletal muscle of UCP1-transgenic mice increased substrate metabolism and ameliorates obesity. (Review) PMID: 27916644
  26. In the absence of regulators (fatty acids, retinoids), rodent UCP1 presents a high ohmic proton conductance that cannot be detected in human UCP1. PMID: 27750036
  27. The uncoupling of oxidative phosphorylation through a proton conductance pathway across the mitochondrial inner membrane is the mechanism for heat production in brown adipose tissue regulated by UCP1. (Review) PMID: 27621146
  28. Brown and beige adipose tissues activate UCP1 protein in dissimilar fashion in response to cold temperature and depending on adipocytes differentiation state. PMID: 28109720
  29. ATGL activity is required for UCP1 activation in intact adipocytes. (Review) PMID: 27986537
  30. Metabolically inert perfluorinated fatty acids directly activate brown adipose tissue UCP1. PMID: 26041126
  31. Mice acclimatized to thermoneutrality revealed that Cpt2A-null interscapular brown adipose tissue failed to induce the expression of thermogenic genes such as Ucp1 and Pgc1a. PMID: 26854223
  32. Data show that fish oil intake increased oxygen consumption and rectal temperature, with concomitant upregulation of mitochondrial uncoupling protein 1 (UCP1) and beta3 adrenergic receptor (beta3AR). PMID: 26673120
  33. Skin temperature in the interscapular region of neonates was lower in uncoupling protein 1 knockout pups employed as a positive control, but not in Cox7a1 knockout pups PMID: 26635001
  34. PKA-dependent IRE1alpha-XBP1 activation is crucial for the transcriptional induction of Ucp1 in brown adipocytes. PMID: 26568450
  35. FGF21-mediated improvements in clearance of a glucose challenge require UCP1. PMID: 26586424
  36. antioxidant chemicals (such asN-acetylcysteine and Mn(III)tetrakis(4-benzoic acid)porphyrin chloride) and SB203580 (a known suppressor ofUcp1expression) decreasedUcp1and oxygen consumption inNrf2-deficient fibroblasts PMID: 26841864
  37. Data suggest beta-adrenergic activation of brown adipocytes leads to dissociation of Hdac1 from promoters of Ucp1/Pgc1a, to up-regulation of histone H3 acetylation, to dissociation of polycomb repressive complexes, and to up-regulation of thermogenesis. PMID: 26733201
  38. thermogenic mitochondrial reactive oxygen species alter the redox status of cysteine thiols in brown adipose tissue to drive increased respiration, and that Cys253 of UCP1 is a key target PMID: 27027295
  39. abundance decreased even more in cold-acclimated UCP1 knockout mice PMID: 26518386
  40. These data indicate that several important metabolic endpoints of FGF21 are UCP1 independent PMID: 25956583
  41. Data suggest that expression of Ucp1 in skeletal muscle can be regulated by dietary factors; the prebiotic epilactose prevents high-fat diet-induced obesity apparently via up-regulation of Ucp1 expression in skeletal muscles and brown adipose tissue. PMID: 26395755
  42. Data indicate that uncoupling protein 1 (UCP1) is required for the dietary methionine restriction (MR)-induced increase in energy expenditure (EE) but not insulin sensitivity. PMID: 25742717
  43. UCP1 and SLN are required to maintain optimal thermogenesis and loss of both systems compromises survival of mice under cold stress PMID: 25825499
  44. improved metabolism produced by oral administration of resveratrol is, at least in part, associated with increased thermogenesis followed by high expression of UCP1 and SIRT1 PMID: 24468941
  45. An experimental model of sleep apnea produced changes in uncoupling protein-1 expression and adiponectin levels. These results confirm previous findings on the response of brown adipose tissue to intermittent hypoxia. PMID: 24337908
  46. Data indicate that uncoupling protein 1 (UCP1) is not involved in control of reactive oxygen species production in brown-fat mitochondria. PMID: 24769119
  47. Zfp516 directly binds to the proximal region of the UCP1 promoter, not to the enhancer region where other transcription factors bind, and interacts with PRDM16 to activate the UCP1 promoter. PMID: 25578880
  48. We also found elevated mRNA levels of UCP-1 and Cidea after exposure to T3. PMID: 24771016
  49. Data indicate that the mobilization of free fatty acids (FFAs) was observed in interscapular brown adipose tissue (iBAT) of wild-type (WT) and uncoupling protein 1 (UCP1)-knockout mice. PMID: 24343897
Database Links

KEGG: mmu:22227

STRING: 10090.ENSMUSP00000034146

UniGene: Mm.4177

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in brown adipose tissue.

Q&A

What is Ucp1 and what is its primary function?

Ucp1 is a unique mitochondrial membranous protein exclusively devoted to adaptive thermogenesis, a specialized function performed by brown adipocytes. Among the approximately 40 members of the mitochondrial metabolite carrier family, Ucp1 stands out as the only protein capable of translocating protons through the inner membrane of brown adipocyte mitochondria. This proton translocation process uncouples respiration from ATP synthesis, resulting in energy dissipation in the form of heat while stimulating high levels of fatty acid oxidation .

The thermogenic function of Ucp1 has been definitively demonstrated through studies with Ucp1 knockout mice, which exhibit a cold-sensitive phenotype. When these mice lacking Ucp1 are exposed to cold temperatures, they are unable to maintain body temperature, highlighting the essential role of this protein in thermogenesis .

How does Ucp1 differ from other uncoupling protein homologs?

While several homologs of Ucp1 (including Ucp2, Ucp3, and Ucp4) have been identified, they are biochemically and physiologically distinct from Ucp1. The key difference lies in their functional capabilities:

  • Only Ucp1 possesses the ability to translocate protons through the inner mitochondrial membrane

  • Other Ucp homologs do not contribute to adaptive thermogenesis, as demonstrated by Golozoubova et al. (2001)

  • Ucp1 has highly specific expression in brown adipocytes, whereas other homologs have broader tissue distribution

  • Ucp1 has distinct regulatory mechanisms involving fatty acids and purine nucleotides

This functional specialization makes Ucp1 unique within its protein family and central to thermogenic processes in brown adipose tissue.

What are the optimal detection methods for Ucp1 in experimental settings?

Multiple complementary techniques can be employed for detecting Ucp1, each with specific advantages depending on the experimental question:

Western Blot Analysis:

  • Can detect Ucp1 at approximately 33 kDa under reducing conditions

  • Allows distinction from other Ucp homologs with high specificity

  • Recommended buffer: Immunoblot Buffer Group 2

  • Antibody concentration: 0.5 μg/mL of Mouse Anti-Human/Mouse Ucp1 Monoclonal Antibody

Immunohistochemistry/Immunofluorescence:

  • Enables visualization of Ucp1 localization within tissues and cells

  • Shows specific staining in cytoplasm of brown adipocytes

  • Protocol: Fixed cells stained with 10 μg/mL antibody for 3 hours at room temperature

  • Secondary detection using fluorescent-conjugated antibodies with DAPI counterstain

Flow Cytometry:

  • Allows quantitative analysis of Ucp1 expression at cellular level

  • Requires cell fixation with Flow Cytometry Fixation Buffer

  • Permeabilization with Flow Cytometry Permeabilization/Wash Buffer I

  • Enables analysis of expression levels across cell populations

Simple Western Analysis:

  • Alternative to traditional Western blotting

  • Detects Ucp1 at approximately 37 kDa

  • Recommended concentration: 2.5 μg/mL antibody

  • Utilize 12-230 kDa separation system under reducing conditions

What controls should be included when studying Ucp1?

When designing experiments to study Ucp1, appropriate controls are essential for reliable interpretation of results:

  • Positive tissue controls: Brown adipose tissue from mice serves as an ideal positive control, while white adipose tissue can serve as a comparative control with minimal Ucp1 expression

  • Protein specificity controls: Include recombinant Ucp2, Ucp3, and Ucp4 when testing antibody specificity to ensure selective detection of Ucp1

  • Cellular models: Undifferentiated versus differentiated adipocytes to demonstrate induction of Ucp1 expression during brown adipogenesis

  • Isotype antibody controls: Essential for immunostaining and flow cytometry to account for non-specific binding

  • Environmental condition controls: Since Ucp1 expression can be influenced by temperature, experiments should control for and document environmental conditions

How is Ucp1 gene expression regulated?

Ucp1 expression is regulated through multiple mechanisms that operate at transcriptional, post-transcriptional, and post-translational levels:

Transcriptional Regulation:

  • Ucp1 biosynthesis is primarily controlled at the transcriptional level

  • Cold exposure activates transcription within minutes in rodents

  • Sympathetic nervous system activation of brown adipocytes leading to increased cAMP levels serves as the primary trigger

  • Transcription is influenced by several factors including:

    • β-adrenergic receptor activation

    • Thyroid hormone (T3)

    • PPARγ and PGC-1α pathways

    • Environmental temperature (negative correlation observed between outdoor temperature and Ucp1 levels in epicardial adipose tissue)

Molecular Markers Associated with Ucp1 Expression:
Several genes cluster with Ucp1 expression and serve as markers for thermogenic adipose tissue:

Tissue TypeMarker GenesRelationship to Ucp1
Brown FatPgc1a, Prdm16, Cpt1b, Cox4i1Co-expressed with Ucp1
Beige FatTmem26, Slc36a2, Tnfrsf9, Tbx1, P2rx5Cluster with Ucp1 in epicardial adipose tissue
White FatHoxc9Negatively correlated with Ucp1 expression

What experimental models are available for studying Ucp1 function?

Several experimental models have been developed to investigate Ucp1 expression and function:

ThermoMouse Model:

  • Transgenic reporter mouse with luciferase activity that mimics endogenous Ucp1 expression

  • Allows real-time visualization and quantification of Ucp1 expression in live animals

  • Responds faithfully to physiological stimuli affecting Ucp1

  • Suitable for both in vitro cell culture studies and in vivo animal experiments

Cell Culture Systems:

  • Immortalized brown adipocyte cell lines

  • Primary brown adipocytes isolated from mice

  • Mesenchymal stem cells differentiated into adipocytes

  • 3T3-L1 mouse embryonic fibroblast adipose-like cell line

Transplantation Models:

  • Subcutaneous implantation of Ucp1-luciferase preadipocytes

  • Allows monitoring of Ucp1 expression in response to treatment (e.g., rosiglitazone)

  • Transplanted cells form discrete adipose tissue containing multilocular adipocytes positive for Ucp1

Knockout and Transgenic Models:

  • Ucp1-/- mice exhibit cold sensitivity and develop obesity under thermoneutral conditions

  • Transgenic Ucp1 expression in fat increases oxygen consumption and reduces body weight gain

How do functional assays for Ucp1 activity work?

Several approaches can be employed to assess Ucp1 activity:

Respirometry Measurements:

  • Measures oxygen consumption in isolated mitochondria or whole cells

  • Can detect uncoupling activity by assessing oxygen consumption not coupled to ATP synthesis

  • Requires careful control experiments with specific inhibitors

Thermogenic Capacity Assessment:

  • Whole-body energy expenditure measurements in response to adrenergic stimulation

  • Example: WWL113-treated mice showed more robust increase in energy expenditure upon CL-316,243 injection compared to controls

  • Parameters to monitor include:

    • Basal energy expenditure

    • Stimulated energy expenditure

    • Locomotor activity (as control)

    • Food intake (as control)

    • Heart rate (as control)

Mitochondrial Membrane Potential:

  • Fluorescent probes can be used to measure proton leak across the inner mitochondrial membrane

  • Decreased membrane potential indicates uncoupling activity

What is the molecular structure of Ucp1 and how does it relate to function?

Recent research has fundamentally revised our understanding of Ucp1's molecular structure:

Monomer vs. Dimer Structure:

  • Contrary to the long-held belief that Ucp1 functions as a dimer, recent evidence demonstrates that Ucp1 is monomeric

  • Novel purification methods using covalent chromatography have enabled preparation of Ucp1 in defined conditions free of excess detergent and lipid

  • Each Ucp1 monomer binds one nucleotide molecule, challenging the previous model of one nucleotide per dimer

Lipid Interactions:

  • Unlike previous assumptions, Ucp1 does bind cardiolipin

  • Each Ucp1 protein binds three cardiolipin molecules, which confer stability to the protein

  • This finding contradicts earlier beliefs that Ucp1, unlike the related mitochondrial ADP/ATP carrier, does not interact with cardiolipin

Functional Implications:

  • The revised understanding of Ucp1 structure is crucial for resolving the controversial mechanism of this important membrane protein

  • The 1:1 stoichiometry of nucleotide binding may explain aspects of the regulatory mechanism

  • Cardiolipin binding may play an essential role in proper protein function and stability

How can Ucp1 be targeted for potential therapeutic applications?

Given the role of Ucp1 in energy expenditure, it represents a potential therapeutic target for metabolic disorders:

Small-Molecule Modulators:

  • Phenotypic screening approaches using adipocytes derived from models like ThermoMouse can identify compounds that modulate Ucp1 expression

  • One identified compound, WWL113, increases Ucp1 expression in brown fat cells and enhances Ucp1 expression in vivo

  • Such compounds enhance adaptive thermogenic capacity and energy expenditure upon adrenergic stimulation

Advantages over Direct Uncouplers:

  • Small-molecule mitochondrial uncouplers like 2,4-dinitrophenol proved too toxic as weight loss agents

  • In contrast, Ucp1-mediated uncoupling is a highly regulated process requiring direct binding of long-chain free fatty acids to Ucp1 in response to physiologic cAMP signaling

  • This regulated mechanism offers a potentially safer approach to enhance whole-body thermogenic capacity

Target Tissues:

  • While classical brown adipose tissue is the primary Ucp1-expressing tissue, Ucp1 has also been detected in other depots:

    • Epicardial adipose tissue (eAT)

    • Mediastinal adipose tissue (mAT)

    • These depots show differential expression patterns of thermogenic markers and beige fat markers

What are the challenges in translating mouse Ucp1 research to human applications?

Several challenges exist in translating findings from mouse models to human applications:

Tissue Distribution Differences:

  • Humans have less classical brown adipose tissue compared to mice

  • Human thermogenic fat may be more similar to beige fat in mice

  • The presence and regulation of Ucp1 in various human adipose depots (like epicardial adipose tissue) need further characterization

Environmental and Physiological Factors:

  • Outdoor temperature affects Ucp1 expression in epicardial adipose tissue (negative correlation)

  • The significance of this relationship in humans living in temperature-controlled environments is unclear

  • Developmental differences in Ucp1 expression between humans and mice

Methodological Limitations:

  • Direct measurement of thermogenesis in human tissue samples is technically challenging

  • Ethical constraints limit experimental approaches in humans

  • Individual variability in Ucp1 expression and activity in humans may be greater than in inbred mouse strains

What are the optimal conditions for working with recombinant Ucp1?

When working with recombinant Ucp1, several critical parameters should be considered:

Purification Methods:

  • Novel methods using covalent chromatography allow preparation of Ucp1 in defined conditions

  • This approach produces protein free of excess detergent and lipid

  • Important for obtaining functionally relevant preparations

Stability Considerations:

  • Cardiolipin binding (three molecules per Ucp1) confers stability to the protein

  • Consider preservation of lipid interactions when designing purification strategies

  • Buffer composition, pH, and temperature affect stability

Expression Systems:

  • E. coli-based expression systems may lack appropriate post-translational modifications

  • Mammalian or insect cell expression systems may better preserve native characteristics

  • Consider codon optimization for the expression system used

How can researchers accurately quantify Ucp1 expression changes?

Multiple complementary approaches can ensure accurate quantification of Ucp1 expression:

mRNA Quantification:

  • qRT-PCR remains the gold standard for measuring Ucp1 transcript levels

  • Important to use appropriate reference genes for normalization

  • Assess multiple thermogenic markers alongside Ucp1 (Pgc1a, Prdm16, Cpt1b, Cox4i1)

Protein Quantification:

  • Western blot with appropriate loading controls

  • Flow cytometry for single-cell level quantification

  • Immunohistochemistry with image analysis for tissue distribution patterns

Reporter Systems:

  • Luciferase-based reporters like those in ThermoMouse model allow real-time monitoring

  • Bioluminescence imaging can be used for in vivo quantification

  • Reporter activity correlates with endogenous Ucp1 expression

What specialized techniques can assess functional Ucp1 activity?

Beyond expression analysis, functional assessment of Ucp1 requires specialized techniques:

Mitochondrial Respirometry:

  • Seahorse XF technology can measure oxygen consumption rate (OCR) in intact cells

  • High-resolution respirometry using Oroboros instruments for isolated mitochondria

  • Key parameters to measure include:

    • Basal respiration

    • ATP-linked respiration

    • Proton leak

    • Maximal respiratory capacity

    • Non-mitochondrial respiration

In Vivo Metabolic Assessment:

  • Indirect calorimetry to measure energy expenditure

  • Cold challenge tests to assess thermogenic capacity

  • Pharmacological stimulation with β3-adrenergic agonists (e.g., CL-316,243)

  • Infrared thermography to detect heat production

Mitochondrial Membrane Potential:

  • Fluorescent probes like TMRM or JC-1 can assess changes in mitochondrial membrane potential

  • Flow cytometry or live-cell imaging to quantify membrane potential at cellular level

  • Decreased membrane potential indicates active uncoupling

How does Ucp1 expression compare across different adipose depots?

Ucp1 expression varies significantly across different adipose tissue depots:

Adipose DepotRelative Ucp1 ExpressionCharacteristics
Brown Adipose TissueHighestPrimary thermogenic tissue with multilocular cells
Epicardial Adipose Tissue (eAT)Moderate to HighShows beige-like characteristics
Mediastinal Adipose Tissue (mAT)ModerateIntermediate expression between eAT and sAT
Subcutaneous Adipose Tissue (sAT)Very Low/NegligibleFew exceptions with detectable expression

Gene expression analysis reveals that both eAT and mAT have significantly higher levels of thermogenic markers individually (Ucp1, Prdm16, Cpt1b) and as a group (Ucp1, Ppargc1a, Prdm16, Cpt1b, Cox4i1) compared to sAT .

What molecular markers help identify Ucp1-expressing adipose tissue?

Different molecular signatures help characterize the nature of Ucp1-expressing adipose tissues:

Classic Brown Fat Markers:

  • Zic1 and Lhx8 (typically not detectable in eAT, mAT, or sAT in humans)

Beige Fat Markers:

  • Tmem26, Slc36a2, Tnfrsf9, Tbx1, and P2rx5

  • These markers cluster with Ucp1 specifically in eAT but not in mAT, suggesting a beige-like nature of human eAT

White Fat Markers:

  • Hoxc9 (shows lower expression in eAT compared to sAT)

When grouped together, eAT has the highest levels of beige marker expression and lowest levels of white fat marker expression, whereas mAT shows an expression pattern intermediate between eAT and sAT .

What emerging technologies could advance Ucp1 research?

Several emerging technologies hold promise for advancing Ucp1 research:

CRISPR-Based Approaches:

  • Precise genome editing to study regulatory elements controlling Ucp1 expression

  • Development of knock-in reporter systems for live monitoring

  • Creation of tissue-specific and inducible Ucp1 models

Single-Cell Analysis:

  • Single-cell RNA sequencing to identify heterogeneity within Ucp1-expressing cell populations

  • Spatial transcriptomics to map Ucp1 expression in tissue context

  • Correlation of Ucp1 expression with other cellular features

Advanced Imaging:

  • Live-cell super-resolution microscopy to visualize Ucp1 in mitochondria

  • Intravital microscopy to monitor Ucp1 activity in living animals

  • PET imaging with specialized tracers to quantify brown fat activity in humans

How might understanding Ucp1 lead to novel therapeutic approaches?

The unique properties of Ucp1 suggest several potential therapeutic approaches:

Pharmacological Activation:

  • Development of small molecules that enhance Ucp1 expression in adipose tissue

  • Compounds targeting the transcriptional regulation of Ucp1

  • Molecules that modulate Ucp1 activity rather than expression

Cell-Based Therapies:

  • Transplantation of engineered Ucp1-expressing cells

  • Reprogramming of white adipocytes to Ucp1-positive beige/brown adipocytes

  • Stem cell-derived brown adipocytes for metabolic therapy

Precision Medicine Approaches:

  • Genetic profiling to identify individuals most likely to respond to Ucp1-targeted interventions

  • Personalized environmental interventions (e.g., cold exposure protocols)

  • Monitoring of Ucp1 activity as a biomarker for treatment response

These future directions highlight the continued importance of Ucp1 as both a fundamental research topic and a potential therapeutic target for metabolic disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.