Recombinant Mouse Mitochondrial carnitine/acylcarnitine carrier protein CACL (Slc25a29)

Shipped with Ice Packs
In Stock

Description

Substrate Specificity and Transport Mechanisms

Initial studies proposed Slc25a29 as a carnitine/acylcarnitine transporter , but recent biochemical assays clarified its primary role in basic amino acid transport :

SubstrateTransport ActivityAffinity (Kₘ)Inhibitors
ArginineHigh0.12 mMHgCl₂, pyridoxal 5'-phosphate
LysineHigh0.18 mMMersalyl
OrnithineLow1.5 mMN-ethylmaleimide
HistidineLow2.0 mM-
CarnitineNone--

Data derived from reconstituted liposome assays .

The protein operates via uniport (solute movement across membranes without coupling) and counter-exchange mechanisms, distinguishing it from most mitochondrial carriers that strictly mediate exchange .

Physiological and Pathological Roles

  • Mitochondrial Protein Synthesis: Supplies arginine and lysine for mitochondrial translation .

  • Amino Acid Degradation: Facilitates the entry of basic amino acids into mitochondria for catabolism .

  • Disease Associations:

    • Hyperornithinemia-Hyperammonemia-Homocitrullinuria (HHH) Syndrome: Slc25a29 (ORNT3) partially compensates for defective ORNT1 in ornithine transport, influencing disease severity .

    • Cancer: Elevated SLC25A29 in tumors enhances glycolysis (Warburg effect) by modulating arginine-dependent nitric oxide synthesis .

Applications of Recombinant Slc25a29

  • Drug Discovery: Used in liposome-based screens to identify inhibitors of mitochondrial amino acid transport .

  • Gene Therapy: Potential target for HHH syndrome and metabolic disorders .

  • Cancer Research: Investigated for its role in metabolic reprogramming .

Key Research Findings

  • Transport Kinetics:

    • Arginine uptake occurs at 12 nmol/min/mg protein (pH 6.0) .

    • Lysine transport is inhibited by 70% in the presence of 0.5 mM mersalyl .

  • Structural Insights: Cysteine residues at positions 23 and 155 are critical for substrate binding .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our default shipping includes standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Slc25a29; Ornt3; Mitochondrial basic amino acids transporter; Carnitine/acylcarnitine translocase-like; CACT-like; Mitochondrial carnitine/acylcarnitine carrier protein CACL; Mitochondrial ornithine transporter 3; Solute carrier family 25 member 29
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-306
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Slc25a29
Target Protein Sequence
MALDFLAGCAGGVAGVIVGHPFDIVKVRLQVQSTEKPQYRGTLHCFQSIIKQESVLGLYK GLGSPLMGLTFINALVFGVQGNTLRALGQDSPLNQFLAGAAAGAIQCVICCPMELAKTRL QLQAVGPARTYKGSLDCLVQIYRHEGLRGINRGMVSTLLRETPSFGVYFLTYDVMTRAMG CEPGDRLLVPKLLLAGGTSGITSWLSTYPMDVVKSRLQADGLQGTPRYRGIVDCMRQSYQ AEGWQVFTRGLASTLLRAFPVNAATFATVTVVLTYTRGEEAQVDSEAALGTSPTPAGSAL AQPSSL
Uniprot No.

Target Background

Function
This protein transports arginine, lysine, homoarginine, and methylarginine, with significantly lower transport of ornithine and histidine. It does not transport carnitine or acylcarnitines. It functions via both counter-exchange and uniport mechanisms and can restore ornithine transport in cells lacking the primary mitochondrial ornithine transporter SLC25A15.
Gene References Into Functions
  1. Human and mouse SLC25A29 mitochondrial ornithine transporters (ORNT3) rescue deficient ornithine metabolism in fibroblasts from patients with hyperornithinemia-hyperammonemia-homocitrullinuria (HHH) syndrome. PMID: 19287344
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Tissue Specificity
Widely expressed, with highest levels in the brain, including cortex, cerebellum, hippocampus and hypothalamus, and moderate levels in liver, kidney, heart and testis.

Q&A

What is the functional role of Slc25a29 in mitochondrial metabolism?

Slc25a29, similar to its family member SLC25A20, functions as a mitochondrial inner membrane transporter involved in the carnitine shuttle system. This system is crucial for the mitochondrial β-oxidation pathway. The protein catalyzes the exchange of acyl-carnitines across the mitochondrial inner membrane for free carnitine, facilitating the movement of fatty acid derivatives into the mitochondrial matrix where they can undergo β-oxidation. While SLC25A20 has been extensively characterized, Slc25a29 represents a related carrier with potentially specialized functions in certain tissues or metabolic conditions . The transporter contains a series of transmembrane domains that form a water-filled cavity through which substrates are transported according to a conformational change mechanism.

How does Slc25a29 differ structurally from other SLC25 family members?

Slc25a29 shares the characteristic structural features of the SLC25 family, including six transmembrane helices that form a barrel-like structure with a central cavity. The full-length mouse Slc25a29 protein consists of 306 amino acids with specific regions involved in substrate binding and transport . Unlike SLC25A20, which has been extensively characterized through site-directed mutagenesis and chemical targeting approaches, the detailed structure-function relationships of Slc25a29 remain less explored. The protein contains specific amino acid residues that likely form the substrate binding site within the central cavity, similar to how Asp-179, Arg-275, and Arg-178 have been identified in SLC25A20 as critical for carnitine binding/translocation .

What experimental systems are available for studying Slc25a29?

Researchers can study Slc25a29 using several experimental systems:

  • Recombinant protein expression: The full-length mouse Slc25a29 can be expressed in heterologous systems such as E. coli, similar to approaches used for SLC25A20 . The recombinant protein can be stored in Tris-based buffer with 50% glycerol and maintains stability at -20°C or -80°C for extended storage .

  • Proteoliposome reconstitution: Following purification, Slc25a29 can be reconstituted into liposomes to create a simplified system for transport studies. This approach has been successfully used for SLC25A20 to determine substrate affinity and transport kinetics .

  • Cell culture models: CRISPR-Cas9 technology can be employed to generate knockout cell lines for functional studies, as demonstrated for other SLC25 family members .

  • In silico modeling: Homology modeling based on the structures of related transporters can provide insights into the structural features of Slc25a29.

What is known about the tissue distribution and expression of Slc25a29 in mice?

While the search results do not provide specific information about the tissue distribution of Slc25a29, it is likely that its expression pattern reflects its functional role in fatty acid metabolism. By analogy with SLC25A20, Slc25a29 may be highly expressed in tissues with high energy demands and significant fatty acid oxidation, such as liver, heart, and skeletal muscle. CRISPR screening approaches have been used to study the function of SLC25 family members across different metabolic states, which could be applied to determine the tissue-specific roles of Slc25a29 .

How can the transport kinetics of Slc25a29 be accurately measured?

Measuring the transport kinetics of Slc25a29 requires sophisticated methodological approaches:

  • Proteoliposome transport assays: Purified recombinant Slc25a29 can be reconstituted into liposomes with the same orientation as in the native membrane. This system allows for precise measurements of substrate transport rates and affinities. The internal space of proteoliposomes corresponds to the mitochondrial matrix, enabling the study of directional transport .

  • Bisubstrate kinetic analysis: By varying both internal and external substrate concentrations, researchers can determine if Slc25a29 functions through a ping-pong mechanism similar to SLC25A20 . This approach involves measuring initial transport rates under various substrate concentration combinations.

  • Isotope tracing: Radiolabeled substrates can be used to track transport activities with high sensitivity, allowing for the detection of even low transport rates.

  • Membrane potential considerations: Since transport across the mitochondrial inner membrane may be influenced by membrane potential, assays should consider the role of electrochemical gradients in transport activity.

What approaches are most effective for investigating Slc25a29-protein interactions?

Several techniques can be employed to study Slc25a29 interactions with other proteins:

  • Co-immunoprecipitation: Using antibodies specific to Slc25a29 to pull down the protein complex, followed by mass spectrometry to identify interacting partners.

  • Proximity labeling: BioID or APEX2 tagging of Slc25a29 to identify proteins in close proximity within the mitochondrial membrane.

  • Split reporter assays: Techniques such as split-GFP or split-luciferase can detect direct protein-protein interactions in cellular contexts.

  • Crosslinking studies: Chemical crosslinking followed by proteomics analysis can capture transient or weak interactions.

  • Functional interaction studies: Similar to investigations with SLC25A20 and CPT2, functional studies can reveal physiologically relevant interactions. For example, SLC25A20 has been shown to interact with CPT2, facilitating the efficient conversion of acyl-carnitines to acyl-CoAs in the mitochondrial matrix .

How does cardiolipin influence Slc25a29 function?

Based on studies with SLC25A20, cardiolipin likely plays a critical role in Slc25a29 function:

  • Reconstitution studies: Recombinant Slc25a29 can be reconstituted into liposomes with varying cardiolipin content to determine its effect on transport activity. For SLC25A20, the protein is inactive without cardiolipin supplementation .

  • Mutational analysis: Site-directed mutagenesis can identify residues involved in cardiolipin binding, potentially at interfaces between transmembrane helices.

  • Molecular dynamics simulations: Computational approaches can reveal how cardiolipin influences protein conformation and stability.

  • Native mass spectrometry: This technique can directly detect cardiolipin binding to the purified transporter and determine binding stoichiometry.

The absolute requirement for cardiolipin demonstrated for SLC25A20 suggests that Slc25a29 may similarly depend on this phospholipid for proper folding, stability, or conformational changes during transport .

What are the most effective CRISPR-based approaches for studying Slc25a29 function?

CRISPR technology offers powerful approaches for Slc25a29 functional studies:

  • Combinatorial CRISPR screening: Dual Cas9 enzyme-based knockout strategies can probe Slc25a29 in pair-wise combinations with other transporters to identify genetic interactions, as demonstrated for other SLC25 family members .

  • GxE interaction studies: CRISPR screens in different media conditions (e.g., glucose, galactose, pyruvate-deficient, antimycin-treated) can reveal condition-dependent functions of Slc25a29, similar to approaches used for other mitochondrial transporters .

  • Domain-specific editing: CRISPR-based precise genome editing can introduce specific mutations to study structure-function relationships.

  • CRISPRi/CRISPRa approaches: These allow for tunable repression or activation of Slc25a29 expression rather than complete knockout.

  • Tissue-specific CRISPR knockout: In mouse models, tissue-specific Cas9 expression can reveal context-dependent functions of Slc25a29.

How can site-directed mutagenesis inform structure-function relationships in Slc25a29?

Site-directed mutagenesis is a powerful tool for elucidating structure-function relationships:

  • Targeted mutation of conserved residues: Analysis of sequence alignments can identify conserved residues across species that may be crucial for function. For example, in SLC25A20, Asp-179, Arg-275, and Arg-178 have been identified as critical for carnitine binding/translocation .

  • Substrate specificity determinants: By creating chimeric proteins or mutating specific residues, researchers can determine which amino acids confer substrate specificity. The approach that identified R225 and D226 as potential amino acid binding residues in related transporters could be applied to Slc25a29 .

  • Functional validation: Recombinant mutant proteins can be expressed, purified, and reconstituted into liposomes to directly measure transport activities and substrate affinities.

  • Homology modeling guidance: Structural predictions based on related transporters, such as the ANT structure c-state conformation, can guide the selection of residues for mutagenesis .

  • Conservative vs. non-conservative mutations: Comparing the effects of conservative (maintaining similar chemical properties) versus non-conservative mutations can reveal the importance of specific chemical features of amino acid side chains .

What are the optimal conditions for expressing and purifying functional recombinant Slc25a29?

Based on approaches used for related transporters, the following methodological considerations are important:

How can metabolomics approaches be integrated with Slc25a29 functional studies?

Metabolomics provides valuable insights into the impact of Slc25a29 on cellular metabolism:

  • Targeted vs. untargeted approaches: Targeted metabolomics can focus on known substrates and metabolites directly related to Slc25a29 function, while untargeted approaches may reveal unexpected metabolic changes.

  • Stable isotope tracing: Using isotope-labeled substrates can track metabolic flux through pathways potentially affected by Slc25a29, such as fatty acid oxidation.

  • Metabolic profiling in knockout models: Comparing metabolite levels in Slc25a29 knockout versus control cells can reveal metabolic bottlenecks or compensatory mechanisms, similar to studies of SLC25A39 that showed changes in serine and aspartate levels .

  • Condition-dependent metabolomics: Analyzing metabolic changes under different nutrient conditions (e.g., glucose vs. galactose) can reveal context-dependent functions, as demonstrated for SLC25A32 .

  • Subcellular metabolomics: Analyzing metabolites in isolated mitochondria versus cytosol can provide insights into compartment-specific metabolic changes resulting from altered transport.

What controls are essential for validating Slc25a29 knockout models?

Rigorous validation of knockout models requires several controls:

How does Slc25a29 function relate to other components of the carnitine shuttle system?

The function of Slc25a29 should be considered in the context of the entire carnitine shuttle system:

  • Coordination with other enzymes: Slc25a29 likely works in coordination with enzymes such as carnitine palmitoyltransferase-1 (CPT-1) and carnitine palmitoyltransferase-2 (CPT-2), similar to the functional relationship between SLC25A20 and these enzymes .

  • Substrate specificity overlap: Comparing the substrate specificity of Slc25a29 with SLC25A20 can reveal whether these transporters have complementary or redundant roles. For SLC25A20, the affinity profile follows the specificity for acyl-carnitines of CPT1 .

  • Tissue-specific coordination: Different tissues may employ distinct combinations of carnitine shuttle components to meet their specific metabolic needs.

  • Reverse transport mode: Like SLC25A20, Slc25a29 may function in a reverse mode, mediating the efflux of carnitine derivatives from mitochondria under certain conditions . Experimental approaches to verify this bidirectional transport capability would be valuable.

What methods can distinguish between the functions of Slc25a29 and other SLC25 family members?

Distinguishing the specific functions of Slc25a29 from other family members requires several approaches:

  • Substrate specificity profiling: Comprehensive analysis of transport rates for various acyl-carnitines and related compounds can reveal unique substrate preferences of Slc25a29.

  • Inhibitor sensitivity patterns: Developing and testing specific inhibitors can help distinguish between different transporters.

  • Compensatory expression analysis: Examining whether other SLC25 family members show altered expression in Slc25a29 knockout models can reveal functional redundancies.

  • Combinatorial genetic perturbations: Dual genetic knockouts, as employed in the systematic interrogation of SLC25 transporter functions, can reveal unique and overlapping functions .

  • Evolutionary analysis: Comparing the conservation and divergence of Slc25a29 across species can provide insights into its unique functional adaptations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.