Recombinant Mouse Mitochondrial carrier homolog 1 (Mtch1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Mtch1; Mitochondrial carrier homolog 1; Mitochondrial carrier-like protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-389
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MGASDPEVAPWAPGGAAGMAGAGAGAGARGGAPAGVEARARDPPPAHRAHPRHPRPAAQP SARRMDGGPGAPGSGDNAPTTEALFVALGAGVTALSHPLLYVKLLIQVGHEPMPPTLGTN VLGRKVLYLPSFFTYAKYIVQVDGKIGLFRGLSPRLMSNALSTVTRGSMKKVFPPDEMEQ VSNKDDMKTSLKKVVKETSYEMMMQCVSRMLAHPLHVISMRCMVQFVGREAKYSGVLSSI GKIFKEEGLLGFFVGLIPHLLGDVVFLWGCNLLAHFINAYLVDDSVSDTPGGLGNDQNPG SQFSQALAIRSYTKFVMGIAVSMLTYPFLLVGDLMAVNNCGLRAGLPPYSPVFKSWIHCW KYLSVQGQLFRGSSLLFRRVSSGSCFALE
Uniprot No.

Target Background

Function

Function: A potential mitochondrial transporter; may play a role in apoptosis.

Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion outer membrane; Multi-pass membrane protein.

Q&A

What is Mtch1 and what protein family does it belong to?

Mtch1 is a member of the SLC25 mitochondrial transporter family, classified as an orphan member of this group. The protein is localized to the outer mitochondrial membrane rather than the inner membrane where most SLC25 members reside. Recent research has identified both MTCH1 and MTCH2 as protein insertases of the outer mitochondrial membrane . The protein functions in mitochondrial homeostasis and has been implicated in apoptotic processes, though its exact transport substrate remains to be definitively established .

How does mouse Mtch1 compare structurally and functionally to human MTCH1?

Mouse Mtch1 shares significant homology with human MTCH1, with approximately 37% sequence identity and 57% positives when aligned . Despite this conservation, there appear to be species-specific functional differences. Most notably, while human MTCH1 induces apoptosis upon overexpression, studies in Drosophila have demonstrated the opposite effect, where downregulation of Mtch leads to increased apoptosis . This suggests evolutionary divergence in the functional roles of this protein across species, making mouse models particularly valuable for comparative studies.

What are the key orthologous relationships of Mtch1 across model organisms?

Based on protein BLAST analyses, Drosophila Mtch (GenBank: NM_079145, locus Dme1 CG6851) has been identified as the ortholog to human MTCH1, showing 37% identity and 57% positive amino acid matches . In mouse models, genomically humanized knockin approaches have been developed to replace mouse Mtch1 with human MTCH1, preserving both protein biochemistry and splicing mechanisms . Comparative studies across these species have revealed both conserved and divergent functions, particularly regarding apoptotic regulation.

What are the most effective methods for studying Mtch1 function in vitro?

Several methodological approaches have proven effective for studying Mtch1 function:

  • RNA interference: siRNA-mediated knockdown has been successfully employed to reduce Mtch1 expression in cell lines like BEL-7402 and MHCC-97H, with quantitative RT-PCR confirming knockdown efficiency of 60-80% .

  • Cell viability assays: The CCK-8 (Cell Counting Kit-8) assay has been used to measure proliferation changes following Mtch1 modulation, showing significant decreases in proliferation after Mtch1 knockdown .

  • Migration and invasion assays: Transwell assays effectively quantify the impact of Mtch1 on cellular migration and invasion capabilities, with studies showing reduced rates following Mtch1 knockdown .

  • Protein interaction studies: Co-immunoprecipitation techniques have identified Mtch1 interaction partners, including BAX and presenilin 1, helping elucidate its role in apoptotic pathways .

For optimal results, researchers should combine multiple approaches to comprehensively characterize Mtch1 function in their specific experimental context.

How can researchers generate recombinant mouse Mtch1 for structural and functional studies?

For generating recombinant mouse Mtch1:

What are the methodological considerations when using siRNA to knockdown Mtch1 in cancer cell lines?

When using siRNA to knockdown Mtch1 in cancer cells:

  • siRNA design: Target sequences should be validated for specificity to avoid off-target effects. Studies with liver cancer cell lines have successfully utilized specific siRNA designs against Mtch1 mRNA .

  • Transfection optimization: Cell-specific optimization of transfection conditions is essential, with lipid-based transfection methods showing high efficiency in hepatocellular carcinoma cell lines like BEL-7402 and MHCC-97H .

  • Validation of knockdown: qRT-PCR should be employed to confirm reduction in Mtch1 mRNA levels, with successful studies achieving significant reductions (p<0.05) compared to control siRNA .

  • Functional readouts: Proliferation (CCK-8 assay), migration and invasion (Transwell assay) should be measured 48-72 hours post-transfection for optimal assessment of phenotypic changes .

  • Controls: Both negative control siRNA and untransfected controls should be included to distinguish between specific knockdown effects and potential transfection-related artifacts.

How does Mtch1 contribute to apoptotic pathways in different species and cell types?

The role of Mtch1 in apoptosis shows interesting species-specific differences:

  • Human cells: In human cell systems, MTCH1 induces apoptosis when overexpressed, functioning in a manner independent of BCL-2 family proteins but requiring SMAC . It forms complexes with BAX and mediates presenilin 1-induced apoptosis through a γ-secretase-independent mechanism .

  • Drosophila: Surprisingly, Mtch depletion in Drosophila leads to excessive apoptosis during pupation, preventing completion of development . This finding directly contradicts the human data, suggesting evolutionary divergence in the protein's function.

  • Mouse models: While specific Mtch1 knockout data in mice is limited, genomically humanized Mtch1 mouse models have been developed that may help resolve these cross-species differences .

  • Cancer cells: In liver hepatocellular carcinoma cell lines, Mtch1 knockdown reduces proliferation, suggesting an anti-apoptotic or pro-survival function in this context .

These contradictory findings highlight the context-dependent nature of Mtch1 function and the need for careful experimental design when studying this protein across different model systems.

What is the relationship between Mtch1 and BAX in mediating apoptosis?

The functional relationship between Mtch1 and BAX involves:

  • Complex formation: Research has shown that MTCH1 can form physical complexes with BAX under specific apoptotic conditions .

  • Receptor/anchor function: MTCH1 appears to serve as a receptor or anchor for BAX when expressed at endogenous levels, potentially facilitating BAX localization to mitochondria during apoptosis .

  • BCL-2 independence: Interestingly, while MTCH1 can interact with BAX, it can also induce apoptosis through BCL-2 protein-independent mechanisms when overexpressed .

  • Death receptor connection: MTCH1 has been implicated in apoptotic death induced by activation of the DR6 death receptor, suggesting it may serve as a link between extrinsic and intrinsic apoptotic pathways .

For experimental investigation of this relationship, co-immunoprecipitation studies, subcellular fractionation to track protein localization, and genetic manipulation of both proteins in parallel are recommended approaches.

What is the evidence for Mtch1 involvement in liver hepatocellular carcinoma (LIHC)?

Multiple lines of evidence support Mtch1's role in LIHC:

These findings collectively suggest that MTCH1 functions as an oncogene in LIHC, potentially serving as both a prognostic marker and therapeutic target.

How does Mtch1 expression correlate with clinical outcomes in cancer patients?

Analysis of MTCH1 expression in relation to clinical outcomes has revealed:

How can humanized mouse models be generated to study MTCH1 function?

Genomically humanized mouse models for MTCH1 can be generated through several sophisticated approaches:

  • Homologous recombination in ES cells: Using large homology arms (22-150 kb) for precise replacement of mouse genomic regions with human orthologs . This approach preserves the human protein's biochemistry while maintaining proper gene regulation.

  • Quality control methodology: Indirect capture technology can be employed to enrich for high molecular weight DNA from targeted loci, followed by long-read sequencing (Oxford Nanopore) to validate correct integration .

  • Design considerations: For complex genomic regions, conditional allele engineering approaches can incorporate elements like duplicated exons flanked by loxP sites, allowing for inducible expression of mutations or reversion to wild-type configurations .

  • Selection cassette design: Careful placement of selection cassettes and their subsequent removal is critical to avoid interference with gene expression .

The resulting humanized mice express only human MTCH1 protein at physiological levels, providing an ideal system for studying human MTCH1 function in vivo and testing potential therapeutic interventions in a physiologically relevant context.

What are the technical challenges in distinguishing the functions of Mtch1 from the related protein Mtch2?

Distinguishing between Mtch1 and Mtch2 functions presents several technical challenges:

  • Sequence similarity: Mtch1 and Mtch2 share structural similarities as members of the same protein family, potentially leading to cross-reactivity of antibodies and other detection tools .

  • Functional overlap: Both proteins have been implicated in apoptotic regulation and have recently been described as protein insertases of the outer mitochondrial membrane, suggesting potential functional redundancy .

  • Compensatory mechanisms: Knockout or knockdown of one protein may trigger compensatory upregulation of the other, masking phenotypic effects.

Recommended approaches to address these challenges include:

  • isoform-specific antibodies: Validation of antibody specificity against recombinant proteins is crucial before experimental use.

  • CRISPR-Cas9 gene editing: Generation of single and double knockout cell lines to assess individual and combined functions.

  • Rescue experiments: Complementation with wild-type or mutant versions of each protein to confirm specificity of observed phenotypes.

  • Domain swap experiments: Creation of chimeric proteins to identify functional domains specific to each protein.

How does the function of Mtch1 differ between humans and model organisms like Drosophila?

Significant functional differences in Mtch1 have been observed across species:

  • Apoptotic regulation:

    • Human MTCH1: Induces apoptosis when overexpressed, independent of BCL-2 family proteins but requiring SMAC

    • Drosophila Mtch: Depletion leads to excessive apoptosis during pupation, preventing development completion

  • Developmental requirements:

    • Drosophila: Mtch is essential for development, with mutant flies unable to complete pupation

    • Human/mouse: Comprehensive developmental requirements less well characterized

  • Protein interactions:

    • Human MTCH1: Forms complexes with BAX and presenilin 1, mediating specific apoptotic pathways

    • Drosophila Mtch: Interaction partners less well defined

These cross-species differences highlight the evolutionary divergence in Mtch1 function and underscore the importance of selecting appropriate model systems for specific research questions. Genomically humanized mouse models offer a valuable approach to bridge these differences by studying human MTCH1 in an in vivo context .

What experimental approaches can resolve contradictory findings between different model systems?

To address contradictory findings across model systems:

  • Standardized experimental conditions: Ensure consistent cell types, expression levels, and assay conditions when comparing across systems.

  • Cross-species complementation: Test whether human MTCH1 can rescue phenotypes in Drosophila Mtch mutants or vice versa to identify conserved functional domains.

  • Genomically humanized models: Generate and characterize mouse models where mouse Mtch1 is replaced with the human ortholog, as has been done for other genes like SOD1, TARDBP, and FUS .

  • Domain mapping: Identify specific protein domains responsible for species-specific functions through domain swapping experiments and targeted mutations.

  • Context-dependent analysis: Systematically vary cellular context (cell type, stress conditions, expression levels) to determine when contradictory functions manifest.

  • Proteomics approaches: Compare interaction partners of Mtch1 across species to identify conserved and divergent protein complexes.

By employing these approaches, researchers can determine whether contradictions reflect true biological differences or experimental artifacts, advancing our understanding of Mtch1 function across evolutionary boundaries.

What signaling pathways regulate Mtch1 expression and activity?

While the complete regulatory network governing Mtch1 expression remains to be fully elucidated, several key pathways and mechanisms have been implicated:

  • Transcriptional regulation: Analysis of cancer datasets suggests Mtch1 expression may be controlled by specific transcription factors in hepatocellular carcinoma contexts .

  • Death receptor signaling: Mtch1 has been linked to DR6 death receptor-mediated apoptosis, suggesting potential regulation by extrinsic apoptotic signals .

  • Presenilin 1 interaction: Human MTCH1 interacts with presenilin 1 and can mediate presenilin 1-induced apoptosis in a γ-secretase-independent manner, indicating a potential regulatory connection to Alzheimer's disease-related pathways .

  • Metabolic regulation: Given its mitochondrial localization and potential role in lipid metabolism (similar to MTCH2), Mtch1 may be subject to regulation by metabolic signals, though this requires further investigation.

Research approaches to further elucidate these pathways include promoter analysis, ChIP-seq for identifying transcription factor binding sites, and phosphoproteomic analysis to identify post-translational modifications that regulate Mtch1 activity.

How can researchers distinguish between specific and artifactual effects when studying overexpressed Mtch1?

Distinguishing between physiological and artifactual effects is critical when studying Mtch1, particularly given the observations with related mitochondrial carrier proteins:

  • Titrate expression levels: Research on related mitochondrial carriers has shown that while modest expression levels (~1 μg/mg of mitochondrial protein) produce specific effects, higher expression levels (~11 μg/mg) can cause artifactual effects not representative of native protein function .

  • Include appropriate controls: Always compare to empty vector controls and use inducible expression systems to monitor dose-dependent effects.

  • Validate with endogenous manipulation: Complement overexpression studies with knockdown/knockout of endogenous protein to confirm physiological relevance.

  • Functional rescue experiments: Test whether physiological phenotypes can be rescued by expression at near-endogenous levels.

  • Mutational analysis: Compare wild-type protein with function-altering mutations to distinguish specific activities from general overexpression artifacts.

  • Physiological readouts: Monitor parameters known to be specifically regulated by Mtch1, such as apoptotic markers when studying its role in cell death.

  • Subcellular localization: Confirm proper localization to mitochondria, as mislocalization due to overexpression can produce non-physiological effects.

Following these guidelines will help ensure research findings accurately reflect the true biological functions of Mtch1 rather than artifacts of experimental manipulation.

What are the most promising therapeutic applications targeting Mtch1?

Based on current understanding, several therapeutic applications targeting Mtch1 show promise:

  • Cancer therapy: Given the association between high MTCH1 expression and poor prognosis in hepatocellular carcinoma, along with functional evidence that MTCH1 knockdown reduces proliferation, invasion, and migration, targeted inhibition of MTCH1 represents a potential therapeutic strategy for LIHC .

  • Apoptosis modulation: The role of MTCH1 in apoptotic pathways suggests potential applications in diseases characterized by dysregulated cell death. Context-specific targeting could either enhance (cancer) or inhibit (neurodegeneration) apoptosis as needed.

  • Metabolic disorders: As a member of the mitochondrial carrier family with potential roles in metabolism (by analogy to MTCH2), Mtch1 modulation might offer approaches for metabolic conditions, though this application requires further research.

  • Neurodegenerative diseases: The interaction between MTCH1 and presenilin 1 suggests potential relevance to Alzheimer's disease pathways , while antibodies against MTCH1 have been identified in neuro-Behçet's disease , indicating possible autoimmune applications.

Therapeutic development will require improved understanding of Mtch1's precise molecular functions, development of specific inhibitors or activators, and careful validation in appropriate disease models.

What key questions remain unanswered about Mtch1 function and regulation?

Despite significant progress, several critical questions about Mtch1 remain to be addressed:

  • Transport substrate: As an orphan member of the mitochondrial carrier family, the specific molecule(s) transported by Mtch1 remain unknown. Identification of this substrate would substantially clarify its physiological function.

  • Species-specific differences: The contradictory apoptotic effects observed between human and Drosophila systems require further investigation to understand evolutionary divergence in Mtch1 function .

  • Protein insertase mechanism: Recent identification of MTCH1 as a protein insertase of the outer mitochondrial membrane raises questions about its specific substrates and the molecular mechanism of this activity .

  • Regulatory network: The upstream regulators and downstream effectors of Mtch1 remain incompletely characterized, particularly in non-cancer contexts.

  • Relationship to MTCH2: The functional relationship and potential redundancy between MTCH1 and the related protein MTCH2 requires clarification.

  • Role in normal development: While Drosophila studies suggest essential developmental functions , the role of Mtch1 in mammalian development remains to be fully characterized.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.