Recombinant Mouse Mitochondrial carrier homolog 2 (Mtch2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline for your reconstitution.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
Mtch2; Mitochondrial carrier homolog 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-303
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Mtch2
Target Protein Sequence
ADAASQVLLGSGLTILSQPLMYVKVLIQVGYEPLPPTIGRNIFGRQVCQLPGLFCYAQHI ASIDGRRGLFTGLTPRLCSGVLGTVVHGKVLQYYQESEKPEELGSVTVQKEYSSSFDRVI KETTREMIARSAATLITHPFHVITLRSMVQFIGRESKYCGLCDSIVTIYREEGIVGFFAG LIPRLLGDIISLWLCNSLAYLINTYALDSGVSTMNEMKSYSQAVTGFFASMLTYPFVLVS NLMAVNNCGLAGGSPPYSPIYTSWIDCWCMLQKAGNMSRGNSLFFRKVPCGKTYCYDLRM LI
Uniprot No.

Target Background

Function
The specific substrate is currently unknown. This protein induces mitochondrial depolarization.
Gene References Into Functions

Mitochondrial Carrier Homolog 2 (MTCH2) Function:

  1. MTCH2 plays a crucial role in neuronal cell biology, regulating mitochondrial metabolism, motility, and calcium buffering to modulate hippocampal-dependent cognitive function. (PMID: 28276496)
  2. Overexpression of MTCH2 alters lipid metabolism, potentially contributing to obesity and insulin resistance. (PMID: 27359329)
  3. MTCH2 is a conserved regulator of lipid homeostasis. Its inhibition may offer therapeutic potential for obesity and related disorders, possibly through modulation of ESR1 activity. (PMID: 28127879)
  4. MTCH2 deficiency enhances muscle metabolism, energy expenditure, and heart function, offering protection against diet-induced obesity. (PMID: 26876167)
  5. MTCH2 loss increases mitochondrial oxidative phosphorylation (OXPHOS), promoting hepatic stellate cell (HSC) proliferation. This increased OXPHOS is associated with larger mitochondria, elevated ATP and ROS levels, and resistance to irradiation-induced apoptosis. (PMID: 26219591)
  6. MTCH2 accelerates the conformational change in membrane-bound tBid, facilitating Bax activation. (PMID: 23744079)

Further research is ongoing to fully elucidate the function of MTCH2.

Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MTCH2 and what is its primary function in mitochondria?

MTCH2 is a mitochondrial outer membrane protein that functions as an insertase for α-helical transmembrane proteins. Originally classified as a member of the solute carrier family, MTCH2 has evolved to serve as a "door" for inserting various proteins into the mitochondrial outer membrane. This protein is crucial for mitochondrial-cytoplasmic communication, apoptosis regulation, and mitochondrial dynamics .

Research methodology: MTCH2's function can be studied using genome-wide CRISPR screens combined with in vitro insertion assays. The Weissman and Voorhees labs demonstrated that purified MTCH2 is sufficient to mediate insertion of proteins into reconstituted proteoliposomes, confirming its insertase function .

How does MTCH2 differ structurally from other mitochondrial carrier proteins?

Unlike traditional mitochondrial carriers that form pores for charged species transport, MTCH2 contains a distinctive groove accessible to the membrane and lined with charged and polar residues. AlphaFold2 modeling reveals that MTCH2 has evolved from solute carrier transporters but has adapted to facilitate protein insertion rather than solute transport .

Methodological approach: Structural analysis using AlphaFold2 prediction models combined with targeted mutagenesis of residues that alter the electrostatic potential of intramembrane surfaces has helped identify the unique structural features of MTCH2 that distinguish it from other carrier proteins .

What experimental models are available to study MTCH2 function?

Several experimental systems have been developed to investigate MTCH2:

Model SystemApplicationKey Research Findings
Cell lines (HEK293, MEFs)In vitro mechanistic studiesDemonstrated MTCH2's role in protein insertion and apoptosis
Conditional knockout miceTissue-specific functionsRevealed role in mitochondrial dynamics, metabolism, and cognition
Drosophila modelsCardiac functionShowed MTCH2 deficiency leads to heart tube dilation and dysfunction
Reconstituted proteoliposomesBiochemical analysisEstablished sufficiency for protein insertion

For optimal results, researchers should combine both in vitro assays using purified components and in vivo models to validate physiological relevance .

How is MTCH2 expression regulated in different tissues?

MTCH2 shows differential expression across tissues, with particularly important roles in metabolically active tissues like heart, brain, and adipose tissue. Research indicates that MTCH2 expression can be influenced by metabolic state and stress conditions.

Methodology: Expression analysis using tissue-specific RNA sequencing, qPCR, and Western blotting. For example, studies have documented altered MTCH2 expression in conditions like cardiomyopathy, where specific variants show correlation with disease state .

What is the mechanism by which MTCH2 facilitates protein insertion into the mitochondrial membrane?

MTCH2 functions through a specialized hydrophilic groove within the bilayer that facilitates insertion of tail-anchored (TA), signal-anchored, and multipass proteins into the mitochondrial outer membrane. The mechanism involves:

  • Recognition of transmembrane domains with varying hydrophobicity and charge characteristics

  • Physical association with nascent substrate proteins (demonstrated through site-specific crosslinking)

  • Utilization of membrane-embedded hydrophilic residues to act as a "gatekeeper"

Research approach: Site-specific crosslinking studies have demonstrated that MTCH2 physically associates with nascent substrates during insertion. Mutational analysis targeting charged residues within MTCH2's intramembrane surfaces revealed variants that both enhance and diminish biogenesis of MTCH2-dependent substrates, confirming the critical role of these residues .

How does MTCH2 influence mitochondrial dynamics during starvation-induced hyperfusion?

MTCH2 plays a selective role in starvation-induced mitochondrial hyperfusion (SIMH), a protective response to nutrient deprivation. Research has shown that:

  • MTCH2-deficient cells remain fragmented under starvation conditions, while wild-type cells display robust mitochondrial hyperfusion

  • MTCH2 is not required for all forms of SIMH (e.g., cycloheximide-induced hyperfusion occurs independently of MTCH2)

  • The mechanism involves lysophosphatidic acid (LPA) synthesis pathway

Methodology: In vitro mitochondrial fusion assays measuring matrix content-mixing can be used to quantify fusion efficiency. Studies by Labbé et al. employed matrix-mCherry and matrix-GFP labeled mitochondria mixed in equal amounts with an energy regeneration system to measure the proportion of fused versus unfused mitochondria .

What is the relationship between MTCH2, lysophosphatidic acid synthesis, and mitochondrial fusion?

MTCH2 stimulates mitochondrial fusion in a manner dependent on lysophosphatidic acid (LPA), a bioactive lipogenesis intermediate. Research indicates that:

  • MTCH2 monitors flux through the lipogenesis pathway

  • This information is transmitted to the mitochondrial fusion machinery

  • LPA acts as a signaling molecule in this process

  • Inhibition of LPA synthesis prevents MTCH2-mediated fusion

Experimental approach: Researchers can use FSG67 (100 µM), an inhibitor of LPA synthesis, to block MTCH2-mediated fusion effects. Additionally, lipidomic profiling can be employed to monitor changes in LPA and other lipid intermediates in response to MTCH2 manipulation .

How does MTCH2 deletion affect cellular metabolism and energy balance?

MTCH2 deletion leads to profound metabolic alterations, including:

  • Increased mitochondrial oxidative function

  • Higher energy demand (elevated ADP/ATP ratio)

  • Oxidized cellular environment (NAD+/NADH imbalance)

  • Enhanced catabolism of lipids, amino acids, and carbohydrates

  • Strategic adaptive reduction in membrane lipids with increase in storage lipids

  • Failure of adipocyte differentiation due to inability to support anabolic processes

Metabolic ParameterWild-typeMTCH2 KnockoutEffect
Glucose uptakeBaseline>2-fold increaseEnhanced catabolism
BCAAs (branched-chain amino acids)BaselineIncreasedEnhanced protein catabolism
Unsaturated acylcarnitinesBaselineIncreasedEnhanced fatty acid oxidation
NAD+/NADH ratioBalancedOxidative shiftAltered redox environment
ADP/ATP ratioBaselineIncreasedHigher energy demand

Methodology: Temporal metabolomics and lipidomics approaches combined with oxygen consumption measurements provide comprehensive assessment of metabolic changes in MTCH2-deficient cells .

What is the role of MTCH2 in apoptosis and how does it interact with tBID?

MTCH2 functions as a receptor-like protein for truncated BH3-interacting domain death agonist (tBID) in the outer mitochondrial membrane, playing a crucial role in the mitochondrial apoptotic pathway:

  • Deletion of MTCH2 hinders recruitment of tBID to mitochondria

  • This reduces activation of pro-apoptotic proteins

  • Prevents mitochondrial outer membrane permeabilization

  • Ultimately inhibits apoptosis

Advanced research approach: Conditional knockout models combined with apoptotic stimuli can be used to study MTCH2's role in apoptosis. For example, overexpression of wild-type MTCH2 sensitizes K562 leukemia cells to imatinib treatment, while expression of insertase-deficient MTCH2 mutants fails to enhance apoptotic sensitivity .

How does MTCH2 function as a modifier in cardiomyopathy and other diseases?

MTCH2 has been identified as a genetic modifier in several diseases, particularly cardiomyopathy:

  • Genomic profiling of human cardiomyopathy cases showed enriched genetic variation in MTCH2

  • A truncating variant is overrepresented in cardiomyopathy patients compared to controls

  • Cardiac-specific reduction of MTCH2 in Drosophila models produced heart tube dilation, reduced function, and shortened lifespan

  • MTCH2 deficiency impairs cardiac function by reducing oxygen consumption and increasing glycolysis in a substrate-dependent manner

Research methodology: Combining human genomic profiling with animal models and metabolomic analysis provides a comprehensive approach to understand MTCH2's role in disease. For cardiomyopathy research, optical coherence tomography can evaluate heart tube function in Drosophila models, while metabolomic profiling can assess glucose-derived metabolite flux to the citric acid cycle .

What are the consequences of MTCH2 dysfunction in neurological contexts?

MTCH2 deficiency in the forebrain leads to significant neurological phenotypes:

  • Deficit in hippocampus-dependent cognitive functions (spatial memory)

  • Impaired long-term potentiation (LTP)

  • Reduced rates of spontaneous excitatory synaptic currents

  • Deficits in mitochondrial motility and calcium handling

Methodological approach: Morris Water Maze testing combined with electrophysiological recordings can assess cognitive and synaptic function in MTCH2-deficient models. Mitochondrial tracking in hippocampal neurons helps evaluate motility defects, while calcium imaging techniques reveal deficiencies in calcium buffering .

How can MTCH2 be targeted therapeutically in disease contexts?

Research suggests several potential therapeutic applications for MTCH2 modulation:

  • Cancer therapy: Enhancing MTCH2 activity can increase sensitivity to apoptotic stimuli in cancer cells. For instance, mutations that make MTCH2 more "greedy" for protein insertion enhance pro-apoptotic factor presence in the membrane, increasing cancer cell susceptibility to treatment .

  • Metabolic disorders: MTCH2 inhibition may protect against diet-induced obesity by increasing energy expenditure and preventing adipocyte differentiation .

  • Glioma: MTCH2 knockdown impairs cell migration/invasion and enhances temozolomide sensitivity in glioma cells, suggesting it as a potential target for brain tumor intervention .

Experimental approach: For cancer applications, researchers can employ MTCH2 mutations that alter its insertase activity, measuring apoptosis propensity using flow cytometry with Annexin V/PI staining. For metabolic disorders, targeted inhibition of MTCH2 combined with metabolic phenotyping provides insights into therapeutic potential .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.