Recombinant Mouse Mitochondrial fission process protein 1 (Mtfp1)

Shipped with Ice Packs
In Stock

Description

Introduction

Mitochondria are essential for cellular metabolism and survival, particularly in cardiomyocytes. Mitochondrial Fission Process 1 (MTFP1) is an inner mitochondrial membrane (IMM) protein crucial for cardiac structure and function . Studies using knockout mouse models have revealed that MTFP1 plays a vital role in maintaining cardiac energy metabolism and preventing dilated cardiomyopathy (DCM) .

Molecular Function and Localization

MTFP1 is located in the inner mitochondrial membrane of cardiac mitochondria . It does not appear to be essential for mitochondrial division . Research indicates that MTFP1 is highly expressed in human cardiac tissue .

Impact of MTFP1 Knockout

Studies using cardiomyocyte-specific MTFP1 knockout mice have provided insights into the protein's function. Knockout mice exhibit a progressive dilated cardiomyopathy (DCM) leading to heart failure and reduced lifespan .

Lifespan of MTFP1 Knockout Mice

SexMedian Lifespan (Weeks)
Male26.4
Female37.5

Prior to the onset of DCM, knockout cardiac mitochondria displayed inner mitochondrial membrane defects, including increased proton leak and sensitivity to mitochondrial permeability transition pore opening . MTFP1 interacts physically and genetically with the mitochondrial permeability transition pore . Ablation of MTFP1 does not significantly alter mitochondrial morphology in the heart .

Effects on Cardiac Structure and Function

Echocardiographic studies on MTFP1 knockout mice revealed a progressive decrease in systolic function, culminating in DCM and left ventricle remodeling . Histological analyses of knockout hearts showed left ventricle chamber expansion, myocardial wall thinning, and disruption of myofibril architecture due to fibrosis and collagen deposition .

MTFP1 and Mitochondrial Bioenergetics

MTFP1 plays a role in mitochondrial bioenergetics. Its depletion reduces oxidative phosphorylation (OXPHOS) efficiency in cardiac mitochondria by increasing proton leak through the adenine nucleotide translocase (ANT) .

MTFP1 in Human Health and Disease

Human MTFP1 is encoded by the MTFP1 gene . Overexpression of MTFP1 has been observed to promote the growth of oral squamous cell carcinoma by inducing reactive oxygen species (ROS) production . Further research is needed to fully elucidate the role of MTFP1 in various diseases and cell types to explore its potential as a therapeutic marker .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Specify your desired tag type for preferential development.
Synonyms
Mtfp1; Mtp18; Mitochondrial fission process protein 1; Mitochondrial 18 kDa protein; MTP18
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-166
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Mtfp1
Target Protein Sequence
MSEQQRQGAERDLYRDTWVRYLGYANEVGEAFRSLVPAAVVWLSYGVSSSYVLADAIDKG KKAGEVPSPEAGRNTRMALAVVDTFVWQSLASVAIPGFTINRLCAASLYVLGTMTHWPPT VRKWTTTTLGLLAIPVIIHPIDRSVDFLLDSSLRKLYPSVEKPSTP
Uniprot No.

Target Background

Function
Mitochondrial fission process protein 1 (Mtfp1) is involved in mitochondrial division, likely by regulating membrane fission. Loss of function results in apoptosis.
Gene References Into Functions
  1. Mtfp1 knockdown mitigates doxorubicin-induced cardiotoxicity by inhibiting Dnm1l-mediated mitochondrial fission. PMID: 28643438
  2. Evidence suggests that cell survival following mTOR inhibition is achieved through mitochondrial hyperfusion, with MTFP1 acting as a critical mTORC1 effector in determining cell fate. PMID: 28918902
Database Links

KEGG: mmu:67900

UniGene: Mm.41719

Protein Families
MTFP1 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the subcellular localization of Mtfp1 and how can it be confirmed experimentally?

Mtfp1 (also known as MTFP1 or MTP18) is specifically localized to the inner mitochondrial membrane (IMM). This localization can be experimentally confirmed through multiple complementary approaches:

  • Protease protection assays: When performed on isolated cardiac mitochondria, Mtfp1 remains protected from protease digestion in intact mitochondria but becomes accessible after disruption of the outer mitochondrial membrane, confirming its inner membrane localization .

  • Alkaline carbonate extraction experiments: Mtfp1 remains in the pellet fraction after alkaline carbonate extraction of isolated mitochondria, indicating its integral membrane association rather than peripheral attachment .

  • Immunofluorescence microscopy: Co-localization studies with known inner mitochondrial membrane markers can provide visual confirmation of Mtfp1 localization.

  • Submitochondrial fractionation: Separation of outer membrane, inner membrane, intermembrane space, and matrix fractions followed by immunoblotting can definitively establish the submitochondrial compartment containing Mtfp1.

Understanding this precise localization is critical when designing experiments to study Mtfp1 function, as it places the protein in a position to influence inner membrane integrity, cristae morphology, and bioenergetic functions.

What expression systems are optimal for producing recombinant mouse Mtfp1?

For research-grade recombinant mouse Mtfp1 production, mammalian expression systems, particularly HEK293T cells, have proven most effective. The process typically involves:

  • Expression vector selection: Cloning the mouse Mtfp1 cDNA sequence (NM_026443) into a mammalian expression vector with appropriate promoter elements .

  • Epitope tagging: Addition of C-terminal tags (e.g., MYC/DDK) facilitates purification and detection. The predicted molecular weight of tagged mouse Mtfp1 is approximately 18.8 kDa .

  • Transfection optimization: Using methods such as calcium phosphate precipitation, lipofection, or electroporation, with optimization for transfection efficiency in HEK293T cells.

  • Expression conditions: Culture at 37°C, 5% CO2 for 48-72 hours post-transfection to maximize protein expression.

  • Purification strategy: Affinity chromatography using tag-specific antibodies or resins, followed by optional size exclusion chromatography to ensure protein homogeneity.

  • Buffer composition: Optimal storage in 25 mM Tris-HCl, 100 mM glycine, pH 7.3, with 10% glycerol as a cryoprotectant .

  • Quality control: Verification of purity (>80%) using SDS-PAGE and Coomassie blue staining, with function assessment through appropriate activity assays .

For functional studies, filtration before use in cell culture applications is recommended, although some protein loss may occur during this process .

What in vivo models are most appropriate for studying tissue-specific functions of Mtfp1?

Conditional knockout mouse models have proven invaluable for studying tissue-specific functions of Mtfp1. The dramatically different phenotypes observed in various tissues highlight the importance of choosing appropriate models:

  • Cardiac-specific knockout model:

    • Generation: Crossing Mtfp1LoxP/LoxP mice with Myh6-Cre transgenic mice (expressing Cre under control of α-myosin heavy chain promoter)

    • Phenotype: Progressive dilated cardiomyopathy leading to heart failure and middle-aged death (median lifespan: 26.4 weeks for males, 37.5 weeks for females)

    • Key measurements: Echocardiography, histopathology (fibrosis, myofibril architecture), serum cardiac injury markers (cTNI, MLC-1)

  • Liver-specific knockout model:

    • Generation: Crossing Mtfp1LoxP/LoxP mice with Alb-Cre transgenic mice (expressing Cre under albumin promoter)

    • Phenotype: No overt defects under normal conditions; protection against high-fat diet-induced steatosis and metabolic dysregulation

    • Key measurements: Liver function tests, glucose tolerance, insulin sensitivity, histological assessment of steatosis, lipidomics

  • Transgenic models for interaction studies:

    • FLAG-tagged Mtfp1 expressed from Rosa26 locus allows for immunoprecipitation and interactome analysis

    • Can be combined with tissue-specific Cre expression for targeted studies

Model TypeAdvantagesLimitationsBest Applications
Cardiac KOReveals essential cardiac functionLethal phenotype may limit long-term studiesCardiomyopathy mechanisms, mitochondrial dysfunction in heart failure
Liver KOCompatible with long-term and metabolic challenge studiesMay miss developmental effectsMetabolic disease, steatosis, liver injury models
Inducible KOTemporal control separates developmental from acute effectsIncomplete recombinationAcute vs. chronic effects of Mtfp1 loss

When selecting models, consider the specific research question, whether developmental or adult phenotypes are of interest, and the feasibility of obtaining tissues for ex vivo analyses.

How can researchers accurately assess mitochondrial morphology changes in Mtfp1-modified systems?

Despite its name suggesting involvement in fission, recent evidence indicates Mtfp1 may be dispensable for mitochondrial division in vivo . Accurately assessing mitochondrial morphology requires multiple complementary approaches:

  • Confocal microscopy of live cells:

    • Transfection/transduction with mitochondrially-targeted fluorescent proteins (mitoYFP, mito-DsRed)

    • Parameters to quantify: mitochondrial length, branching points, form factor (measure of complexity), aspect ratio (elongation)

    • Software analysis: ImageJ with mitochondrial morphology plugins or specialized software like Imaris

  • Super-resolution microscopy:

    • Techniques: STED, PALM, or STORM microscopy provides resolution below the diffraction limit

    • Allows visualization of mitochondrial ultrastructure beyond conventional microscopy limits

    • Critical for detecting subtle changes in mitochondrial constriction sites or cristae organization

  • Transmission electron microscopy (TEM):

    • Gold standard for ultrastructural analysis of mitochondria

    • Quantification of mitochondrial area, length, and cristae density

    • Special consideration: Proper fixation techniques are crucial to preserve native morphology

  • Flow cytometry-based approaches:

    • Forward/side scatter properties correlate with mitochondrial size and complexity

    • Can analyze large populations of isolated mitochondria for size distribution shifts

  • Time-lapse imaging:

    • Critical for distinguishing fission/fusion event frequencies rather than just steady-state morphology

    • Requires environmental control during imaging (temperature, CO2, humidity)

From the search results, quantification of mitochondrial mass in primary hepatocytes from Mtfp1-knockout mice showed no differences in fluorescent signal intensity or surface area, and TEM analyses revealed no differences in mitochondrial area or length, contradicting earlier in vitro studies suggesting Mtfp1's role in fission .

How does Mtfp1 regulate mitochondrial membrane potential and proton leak, and what methods best quantify these effects?

Mtfp1 plays a critical role in maintaining mitochondrial membrane potential by regulating proton leak across the inner membrane. Research has revealed that Mtfp1 deletion leads to specific bioenergetic alterations:

  • Membrane potential measurement techniques:

    • Potentiometric fluorescent dyes (TMRM, JC-1) with flow cytometry or microscopy

    • Rhodamine 123 quenching/dequenching kinetics

    • TPP+ electrode measurements in isolated mitochondria

    • Key findings: Mtfp1 knockout cardiac mitochondria display reduced membrane potential

  • Proton leak assessment methodologies:

    • High-resolution respirometry to measure:

      • State 4o respiration (non-phosphorylating, with oligomycin)

      • State 3 respiration (phosphorylating, with ADP)

      • Uncoupled respiration (with FCCP)

    • Simultaneous measurement of oxygen consumption and membrane potential

    • Calculation of respiratory control ratio (RCR = State 3/State 4o)

  • Specific leak pathway identification:

    • Pharmacological inhibitors to pinpoint leak sources:

      • Carboxyatractyloside (CAT) for adenine nucleotide translocase (ANT)

      • Bongkrekic acid as alternative ANT inhibitor

      • Cyclosporin A for mitochondrial permeability transition pore

    • Key finding: Mtfp1 knockout increases futile proton leak dependent upon ANT, which can be rescued by CAT treatment

  • Substrate-specific respiration:

    • Complex I-linked substrates: pyruvate, malate, glutamate

    • Complex II-linked substrate: succinate (with rotenone)

    • Complex IV-linked substrates: TMPD/ascorbate

    • Finding: Mtfp1 ablation in liver enhances oxygen consumption across substrate conditions

  • Comprehensive assessment workflow:

    • Isolate mitochondria from control and Mtfp1-knockout tissues

    • Measure basal respiration rates with various substrates

    • Add ADP to stimulate phosphorylating respiration

    • Add oligomycin to inhibit ATP synthase (reveals leak)

    • Test sensitivity to ANT inhibitors

    • Add uncoupler to assess maximum respiratory capacity

    • Calculate coupling efficiency and control ratios

The evidence indicates that Mtfp1 maintains bioenergetic efficiency by limiting futile proton leak, particularly through the ANT. This function appears to be independent of its originally proposed role in mitochondrial fission .

What mechanisms explain the enhanced OXPHOS activity in Mtfp1-knockout liver without changes in mitochondrial mass?

One of the most intriguing findings is that Mtfp1 deletion in liver enhances oxidative phosphorylation (OXPHOS) independently of mitochondrial biogenesis. Several experimental approaches have illuminated possible mechanisms:

  • Evidence against biogenesis-mediated enhancement:

    • Unchanged mitochondrial mass in Mtfp1-knockout hepatocytes (assessed by mitoYFP fluorescence)

    • No differences in mtDNA content in liver tissue

    • Unaltered mitochondrial area or length by TEM analysis

  • Respiratory chain complex activity measurements:

    • Enhanced oxygen consumption in isolated LMKO liver mitochondria when provided with:

      • Pyruvate, malate, and glutamate (Complex I substrates)

      • Succinate (Complex II substrate)

      • TMPD/ascorbate (Complex IV substrates)

    • This indicates intrinsically enhanced activity of multiple respiratory complexes

  • OXPHOS assembly and stability assessment:

    • Blue Native PAGE analysis of respiratory complexes and supercomplexes

    • Measurement of individual complex activities using spectrophotometric assays

    • Analysis of complex stability under detergent or thermal challenge

  • Post-translational modification analysis:

    • Phosphorylation status of OXPHOS components

    • Acetylation profiles (particularly relevant in liver metabolism)

    • Redox modifications affecting OXPHOS activity

  • Membrane environment investigation:

    • Lipid composition analysis of mitochondrial membranes

    • Cardiolipin content and distribution

    • Membrane fluidity measurements

  • Cristae morphology assessment:

    • High-resolution TEM analysis of cristae density and organization

    • Quantification of cristae junction proteins

    • Correlation between cristae ultrastructure and OXPHOS activity

  • Interactome insights:

    • Mtfp1 interacts with 112 mitochondrial proteins in liver (identified by co-IP/MS)

    • These interactions may directly influence OXPHOS complex assembly or activity

    • Loss of inhibitory interactions may explain enhanced activity in knockout models

The data suggest that Mtfp1 may normally function as a negative regulator of OXPHOS activity in liver, possibly through direct interactions with OXPHOS components or by influencing the local membrane environment that affects respiratory complex function.

How does Mtfp1 influence the mitochondrial permeability transition pore (mPTP) and cell death pathways in different tissues?

Mtfp1 has emerged as a critical regulator of the mitochondrial permeability transition pore (mPTP) with striking tissue-specific effects. Understanding these differential effects requires systematic experimental approaches:

  • Tissue-specific effects on mPTP:

    • In heart: Mtfp1 deletion increases mPTP opening sensitivity

      • Leads to increased cardiomyocyte death

      • Contributes to dilated cardiomyopathy

    • In liver: Mtfp1 deletion inhibits mPTP opening

      • Confers protection against apoptotic liver damage

      • Enhances survival under stress conditions

  • mPTP opening assessment techniques:

    • Calcium retention capacity (CRC) assays:

      • Add incremental calcium doses to isolated mitochondria

      • Monitor calcium release signifying mPTP opening

      • Quantify the calcium threshold required for permeability transition

    • Mitochondrial swelling assays:

      • Measure absorbance decrease as mitochondria swell upon mPTP opening

      • Assess sensitivity to calcium-induced swelling

      • Test protection by cyclosporin A (CsA) to confirm mPTP involvement

    • Fluorescent methods:

      • Calcein-AM/cobalt chloride technique in intact cells

      • TMRM fluorescence collapse during permeability transition

      • Live cell imaging of mPTP opening events

  • Genetic interaction studies:

    • Cyclophilin D modulation:

      • Pharmacological inhibition (CsA)

      • Genetic ablation

      • Key finding: Sensitivity to programmed cell death and mPTP opening in Mtfp1-knockout cells could be rescued by inhibition of Cyclophilin D

  • Cell death pathway analysis:

    • Apoptosis markers:

      • Annexin V/PI staining

      • Caspase activity measurements

      • Cytochrome c release from mitochondria

    • Necrotic markers:

      • Plasma membrane permeability

      • ATP depletion

      • Reactive oxygen species production

  • Experimental workflow for comparative tissue analysis:

    • Isolate mitochondria from cardiac and liver tissues of Mtfp1-knockout and control mice

    • Perform parallel CRC and swelling assays under identical conditions

    • Compare vulnerability to calcium-induced mPTP opening

    • Test sensitivity to pharmacological inhibitors (CsA, bongkrekic acid)

    • Correlate with tissue damage markers in vivo

TissueEffect of Mtfp1 KO on mPTPCell Death OutcomePhenotypic Consequence
HeartIncreased openingEnhanced sensitivityDilated cardiomyopathy, heart failure
LiverInhibited openingProtection against apoptosisResistance to fat-induced steatosis, protection from liver damage

These tissue-specific differences may relate to unique metabolic requirements, differential protein interactomes, or tissue-specific post-translational modifications of Mtfp1 and mPTP components .

What experimental approaches can resolve contradictions in Mtfp1's proposed roles in mitochondrial dynamics versus bioenergetics?

The literature contains apparent contradictions regarding Mtfp1's primary functions. Originally named for its putative role in fission, recent evidence suggests it may be more critical for bioenergetics and membrane integrity. Resolving these contradictions requires:

  • Temporal analysis following Mtfp1 manipulation:

    • Acute vs. chronic effects using inducible knockout systems

    • Time-course experiments tracking:

      • Mitochondrial morphology changes

      • Membrane potential alterations

      • Respiratory function changes

      • Cell death sensitivity

    • Determining whether morphological changes precede or follow bioenergetic alterations

  • Simultaneous assessment of morphology and function:

    • Live-cell microscopy with simultaneous recording of:

      • Mitochondrial network morphology (fluorescent proteins)

      • Membrane potential (TMRM, JC-1)

      • ROS production (MitoSOX, DCF)

      • Calcium dynamics (Rhod-2, GCaMP)

    • Correlation analysis between morphological parameters and functional readouts

  • In vitro vs. in vivo comparison:

    • Early studies suggesting Mtfp1's role in fission were primarily in cell lines

    • Recent in vivo studies show Mtfp1 is dispensable for mitochondrial division in heart and liver tissues

    • Systematic comparison under identical conditions is needed

  • Model-specific responses:

    • Cell lines vs. primary cells

    • Different tissues (heart, liver, neurons)

    • Normal vs. stressed conditions

    • Assessment under various metabolic states

  • Structure-function analysis:

    • Domain mapping to identify regions responsible for different functions

    • Point mutations to disrupt specific interactions

    • Rescue experiments with domain-specific mutants

  • Direct assessment of fission/fusion dynamics:

    • Photoactivatable fluorescent proteins to track mitochondrial mixing

    • Fission/fusion event counting in live cells

    • Assessment of known fission/fusion proteins (Drp1, Mfn1/2, OPA1) in Mtfp1-knockout systems

Recent evidence strongly suggests that, contrary to its name, Mtfp1's primary functions relate to inner membrane integrity, bioenergetic efficiency through regulation of proton leak, and modulation of the mitochondrial permeability transition pore, rather than direct control of the fission machinery .

How does Mtfp1 interact with the mitochondrial fission machinery, particularly Drp1 and its receptors?

While initially named for its putative role in fission, understanding the relationship between Mtfp1 and the canonical fission machinery requires sophisticated experimental approaches:

  • Current understanding of mitochondrial fission components:

    • Drp1 (dynamin-related protein 1): Cytosolic GTPase that assembles into oligomeric rings to drive constriction

    • Mitochondrial receptors that recruit Drp1:

      • Mff (mitochondrial fission factor): Primary receptor that selectively recruits oligomerized Drp1

      • MiD49/51: Can recruit Drp1 dimers, but may sequester inactive forms

      • Fis1: Originally identified as a Drp1 receptor, now implicated in stress-induced fission and mitophagy

  • Experimental approaches to study Mtfp1-Drp1 relationship:

    • Co-immunoprecipitation to test for physical interaction

    • Proximity labeling approaches (BioID, APEX)

    • Analysis of Drp1 recruitment and localization in Mtfp1-knockout cells

    • Assessment of Drp1 phosphorylation status (S616, S637 in humans)

    • Measurement of Drp1 GTPase activity

    • Visualization of Drp1 assembly at mitochondrial constriction sites

  • Comparative analysis with established receptors:

    • Mff selectively interacts with higher-order complexes of Drp1

    • MiD51/49 can recruit Drp1 dimers

    • Assess whether Mtfp1 shows preferences similar to any known receptor

  • Influence on Drp1 post-translational modifications:

    • Phosphorylation at key regulatory sites

    • SUMOylation

    • Ubiquitination

    • Key finding: Pim-1 kinase prevents Drp1 translocation to mitochondria during ischemic challenge by phosphorylation

  • Inner membrane vs. outer membrane fission coordination:

    • Mtfp1 as an IMM protein may coordinate with OMM fission machinery

    • Analysis of potential coordination between Mtfp1 and other IMM division proteins

    • Investigation of cristae remodeling preceding division events

Recent evidence suggests that despite its name, Mtfp1 may be dispensable for mitochondrial fission in vivo . No direct interaction between Mtfp1 and Drp1 has been conclusively demonstrated, and knockout models show normal mitochondrial morphology in liver and heart tissues before the onset of disease .

What is the most effective strategy for identifying and validating the interactome of Mtfp1?

Understanding Mtfp1's diverse functions requires comprehensive characterization of its protein interaction network. An effective interactome analysis strategy includes:

  • Generation of appropriate tagged constructs:

    • Creation of epitope-tagged Mtfp1 (FLAG-MTFP1) expressed from genomic loci (e.g., Rosa26)

    • Verification of proper localization and function through protease protection assays

    • Tissue-specific expression systems for comparative interactome studies

  • Affinity purification coupled with mass spectrometry (AP-MS):

    • Mitochondrial isolation to enrich for relevant compartment

    • Gentle solubilization to preserve protein-protein interactions

    • Co-immunoprecipitation using tag-specific antibodies

    • Mass spectrometry identification of co-precipitated proteins

    • Quantitative analysis to identify specific interactors (fold change >2)

    • From the search results, this approach identified 112 specific interactors of Mtfp1 in liver mitochondria

  • Proximity-based labeling approaches:

    • BioID: Fusion of Mtfp1 with biotin ligase (BirA*) to biotinylate proteins in proximity

    • APEX: Fusion with engineered peroxidase for proximity labeling

    • Advantages: Captures transient interactions and works in native cellular environment

  • Crosslinking mass spectrometry (XL-MS):

    • Chemical crosslinking to covalently link interacting proteins

    • Identification of crosslinked peptides by mass spectrometry

    • Provides spatial constraints for protein complex modeling

  • Validation strategies:

    • Reciprocal co-immunoprecipitation of key interactors

    • Bimolecular fluorescence complementation (BiFC)

    • Förster resonance energy transfer (FRET)

    • Proximity ligation assay (PLA)

    • Genetic interaction studies (synthetic lethality/rescue)

  • Bioinformatic analysis:

    • Gene Ontology enrichment

    • Protein complex and pathway mapping

    • Network analysis to identify hub proteins

    • Comparison with published interactomes of related proteins

  • Tissue-specific and condition-dependent interactions:

    • Comparative analysis between tissues (heart vs. liver)

    • Interactome changes under stress conditions

    • Changes during disease progression

This multi-faceted approach can resolve contradictions in Mtfp1's reported functions by identifying tissue-specific interactors and providing a molecular basis for its diverse roles in different cellular contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.