Recombinant Mouse Mitochondrial folate transporter/carrier (Slc25a32)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Slc25a32 belongs to the mitochondrial carrier superfamily and is ubiquitously expressed across tissues. It localizes to the inner mitochondrial membrane, where it mediates folate and FAD transport. Recombinant mouse Slc25a32 is typically expressed in systems such as E. coli or mammalian cells (e.g., HEK293) with affinity tags (e.g., His-tag) for purification .

Functional Insights

Slc25a32 has dual roles in mitochondrial metabolism:

  • Folate Transport: Transports tetrahydrofolate (THF) into mitochondria, supporting one-carbon metabolism for nucleotide synthesis and methylation reactions .

  • FAD Transport: Facilitates FAD import, essential for flavoenzyme activity in fatty acid β-oxidation and the electron transport chain .

Studies using recombinant Slc25a32 revealed its antiporter mechanism, coupling folate import with FAD export . Disruption of Slc25a32 in mice leads to:

  • Neural tube defects (NTDs) due to mitochondrial folate deficiency .

  • Exercise intolerance and metabolic disturbances linked to impaired FAD-dependent enzymes .

Research Applications

Recombinant mouse Slc25a32 is pivotal in:

  • Disease Modeling:

    • Slc25a32 knockout mice exhibit 100% penetrant cranial NTDs, rescued by formate supplementation .

    • Mutations in Slc25a32 (e.g., Y174C, K235R) impair mitochondrial FAD uptake, causing riboflavin-responsive exercise intolerance (RREI) .

  • Mechanistic Studies:

    • Reconstitution assays demonstrate its substrate specificity for THF and FAD .

    • Interaction studies identify partners like dihydrolipoamide dehydrogenase (DLD), linking folate metabolism to glycine cleavage .

Table 1: Functional Studies of Recombinant Slc25a32

Study FocusMethodologyKey OutcomeSource
Folate TransportGene-trap inactivation in miceNTDs due to mitochondrial THF shortage; formate supplementation rescues NTDs .
FAD TransportYeast complementation assaysRescue of FAD transport defects in FLX1-mutant yeast .
Metabolic ProfilingMetabolomic analysis of KO miceGlycine accumulation, formate deficiency, and disrupted one-carbon metabolism .
Pathway InteractionsCo-IP and enzyme activity assaysImpaired fatty acid β-oxidation and serine metabolism in Slc25a32 mutants .

Clinical Relevance

  • Human Homologs: Biallelic SLC25A32 mutations are associated with RREI and NTDs .

  • Therapeutic Potential: Formate supplementation bypasses mitochondrial folate deficits, offering a strategy for folate-resistant NTDs .

Ongoing Debates

  • Substrate Specificity: Conflicting evidence exists on whether Slc25a32 primarily transports folate, FAD, or both .

  • Mechanism: Proposed models include unidirectional folate transport vs. folate-FAD antiport .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations are stable for 6 months at -20°C/-80°C, while lyophilized forms are stable for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your desired tag type for preferential development.
Synonyms
Slc25a32; Mftc; Mitochondrial folate transporter/carrier; Solute carrier family 25 member 32
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-316
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Slc25a32
Target Protein Sequence
MTGQGQSAAGSAAWSAVFRHVRYENLVAGVSGGVLSNLALHPLDLVKIRFAVSDGLEVRP KYKGILHCLATIWKVDGLRGLYQGVTPNVWGAGLSWGLYFFFYNAIKSYKTEGRAEQLEP LEYLVSAAEAGAMTLCITNPLWVTKTRLMLQYGGVASPSQRQYKGMFDALVKIYKYEGVR GLYKGFVPGLFGTSHGALQFMAYELLKLKYNKHINRLPEAQLSTAEYISVAALSKIFAVA ATYPYQVVRARLQDQHVSYGGVTDVITKTWRKEGIGGFYKGIAPNLIRVTPACCITFVVY ENVSHFLYDLREKKVS
Uniprot No.

Target Background

Function
This protein transports folate across the inner mitochondrial membrane. It also facilitates the transport of FAD across the same membrane.
Gene References Into Functions
  1. Studies have shown that loss-of-function mutations in Slc25a32 result in cranial neural tube defects (NTDs) in mice and have been observed in a human NTD patient. PMID: 29666258
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the Slc25a32 protein and what is its primary function in cellular metabolism?

Slc25a32 (mitochondrial folate transporter/carrier) is a 35 kDa transport protein encoded by the Slc25a32 gene located on chromosome 8q22.3 in humans. It belongs to the mitochondrial carrier superfamily and serves dual critical functions:

  • Facilitates the transfer of tetrahydrofolate (THF) species across the inner mitochondrial membrane to support mitochondrial one-carbon metabolism

  • Functions as a mitochondrial flavin adenine dinucleotide (FAD) transporter, as demonstrated by its ability to complement yeast strains with mitochondrial FAD transport defects

The protein is ubiquitously expressed across tissues and plays an essential role in connecting cytosolic and mitochondrial folate metabolism, which is crucial for various cellular processes including DNA synthesis, amino acid metabolism, and mitochondrial function .

How does the structure of Slc25a32 relate to its transport function?

Slc25a32 contains seven exons that encode the functional transporter with specific domains that facilitate substrate recognition and transport. The protein's structure includes transmembrane domains that span the inner mitochondrial membrane, creating a channel through which folate derivatives and potentially FAD can move .

Key structural features include:

  • Conserved amino acid residues that are critical for substrate binding, particularly positions Y174 and K235

  • Transmembrane helices that form the substrate translocation pathway

  • Substrate binding sites that recognize tetrahydrofolate derivatives and potentially FAD

Mutations in these conserved regions, such as Y174C and K235R, disrupt the protein's transport function, providing insight into structure-function relationships essential for experimental design .

What mouse models are available for studying Slc25a32 function and which is most appropriate for neural tube defect research?

Several mouse models have been developed to study Slc25a32 function, each with specific applications:

Mouse ModelGenotypePhenotypeBest Application
Homozygous knock-inY174C/Y174CMild motor impairmentExercise intolerance studies
Homozygous knock-inK235R/K235RBiochemical disturbancesMetabolic pathway analysis
Compound heterozygous knockoutY174C/K235REmbryonic lethality with NTDsNeural tube defect research
Gene-trapped knockout-/-Cranial NTDsDevelopmental studies

For neural tube defect research specifically, the compound heterozygous Y174C/K235R knockout model is most appropriate as it consistently produces embryos with neural tube defects, making it ideal for studying prevention strategies and mechanisms . Researchers should note that the homozygous knockouts (-/-) also exhibit NTDs but with variable penetrance, while the Y174C/K235R model shows more consistent phenotypes.

What are the optimal methods for genotyping Slc25a32 mutant mice?

Optimal genotyping of Slc25a32 mutant mice involves PCR amplification followed by sequencing:

  • Extract DNA from either tail clips (adult mice) or embryonic amnion

  • Perform PCR using primers that flank the mutation sites:

    • Forward primer: 5′-AATATGGATTGCATGAAACAGTACC-3′

    • Reverse primer: 5′-TGTACTCTGTAGTCTTGGATGGGAA-3′

  • Sequence the PCR amplicons to identify specific mutations (Y174C, K235R)

  • For knockout verification, use primers located on exon 2 and 7 of Slc25a32 to amplify a 678-bp amplicon

For RNA expression analysis, real-time quantitative PCR should be performed using primers:

  • 5′-ATGGGTGACGAAAACTCGCCTT-3′

  • 5′-CGCACCATGTGATGTTCCAAA-3′

GAPDH should be used as a loading control, and results should be normalized to wild-type expression levels .

How can researchers effectively measure flavoenzyme activity in Slc25a32 mutant models?

To effectively measure flavoenzyme activity in Slc25a32 mutant models:

  • Tissue preparation:

    • Harvest skeletal muscle or other relevant tissues

    • Prepare homogenates under conditions that preserve enzyme activity

    • Maintain samples at 4°C throughout processing

  • Acyl-CoA dehydrogenase activity assays:

    • Measure activities of SBCAD, IVD, IBD, GCDH, SCAD, MCAD, and VLCAD using spectrophotometric methods

    • Perform assays both with and without exogenous FAD supplementation

    • Calculate enzyme activity relative to wild-type controls

  • Dihydrolipoamide dehydrogenase (DLDH) activity measurement:

    • Use spectrophotometric methods following established protocols

    • Monitor reaction rate over time with appropriate substrates

    • Express results as a ratio compared to wild-type activity levels

These assays should be performed in parallel reaction systems with and without FAD supplementation to determine the FAD-dependency of the observed defects.

What is the relationship between Slc25a32 dysfunction and folate-mediated one-carbon metabolism?

Slc25a32 dysfunction affects folate-mediated one-carbon metabolism (FOCM) through several interconnected mechanisms:

  • Impaired mitochondrial folate uptake:

    • Reduced transport of tetrahydrofolate into mitochondria

    • Abnormal distribution of folate intermediates between cytosolic and mitochondrial compartments

  • Glycine metabolism disruption:

    • In Slc25a32-/- embryos, dihydrolipoamide dehydrogenase (a subunit of the glycine cleavage system) is damaged

    • This results in glycine accumulation and reduced glycine-derived formate production

    • Formate is essential for folate-mediated one-carbon metabolism

  • Folate intermediate imbalance:

    • Shortage of 5-methyltetrahydrofolate (CH3-THF)

    • Accumulation of other folate intermediates

    • Absence of all folate intermediates in mitochondria in Y174C/K235R and K235R/K235R mice

  • Disruption of purine biosynthesis:

    • The connection between Slc25a32 function and de novo purine biosynthesis pathways

    • This is evidenced by the rescuing effect of galactose on Slc25a32 knockout cell growth

These findings highlight how Slc25a32 connects mitochondrial FAD transport, folate metabolism, and broader cellular metabolic networks.

How does Slc25a32 deficiency affect mitochondrial FAD transport and flavoenzyme function?

Slc25a32 deficiency specifically impairs mitochondrial FAD transport with cascading effects on flavoenzyme function:

  • Direct blockage of FAD transport:

    • Y174C/Y174C, Y174C/K235R, and K235R/K235R mutations block mitochondrial FAD uptake

    • This creates a mitochondrial FAD shortage

  • Flavoenzyme dysfunction pattern:

    • Strong positive correlation between Slc25a32 dysfunction severity and flavoenzyme deficiency

    • Affects multiple metabolic pathways:

      • Fatty acid β-oxidation enzymes (SBCAD, IVD, IBD, GCDH, SCAD, MCAD, VLCAD)

      • Amino acid metabolism enzymes

      • Respiratory chain components

  • Selective vulnerability:

    • Different flavoenzymes show varying sensitivity to FAD deficiency

    • This creates a specific pattern of metabolic disruption characterized by:

      • Impaired fatty acid oxidation

      • Abnormal amino acid metabolism

      • Compromised mitochondrial respiration despite intact electron transport chain components

The differential sensitivity of various flavoenzymes to FAD deficiency explains the complex metabolic phenotype observed in both patients and mouse models.

What is the evidence linking Slc25a32 mutations to neural tube defects, and how might these be prevented?

Evidence linking Slc25a32 mutations to neural tube defects (NTDs) comes from multiple sources:

  • Human genetic studies:

    • Biallelic loss-of-function variants in SLC25A32 have been identified in human fetuses with NTDs

    • Resequencing of DNA from NTD patients has revealed SLC25A32 mutations

  • Mouse models:

    • Homozygous knockout (Y174C/K235R) mice die in utero with NTDs

    • Gene-trapped knockout mice present with cranial NTDs in the embryonic stage

  • Mechanistic link:

    • Folate-mediated one-carbon metabolism abnormality is a critical modifier of neural tube closure risk

    • Slc25a32 mutations disrupt this pathway by causing:

      • Glycine accumulation

      • Reduced glycine-derived formate

      • 5-methyltetrahydrofolate shortage

Prevention strategies supported by research:

  • Formate supplementation:

    • Maternal formate supplementation increases 5-methyltetrahydrofolate levels

    • This intervention ameliorates NTDs in Slc25a32-/- embryos

    • Suggests a potential preventive approach for human cases

  • Folate supplementation:

    • Traditional folate supplementation may help but might be insufficient alone

    • Combination strategies targeting both folate and formate metabolism may be more effective

These findings suggest potential targeted interventions for pregnancies at risk due to SLC25A32 mutations.

What is the connection between Slc25a32 and riboflavin-responsive exercise intolerance (RREI)?

The connection between Slc25a32 and riboflavin-responsive exercise intolerance (RREI) is multifaceted:

  • Clinical evidence:

    • Mutations in SLC25A32 cause the condition known as "riboflavin-responsive exercise intolerance"

    • First case report linking RREI to SLC25A32 was published in 2016

    • Several additional cases have been documented since then

  • Phenotypic similarity:

    • SLC25A32 deficiency phenotype resembles multiple acyl-CoA dehydrogenase deficiency (MADD)

    • Characterized by exercise intolerance, fatigue, and biochemical abnormalities

    • The condition responds to riboflavin (vitamin B2) supplementation

  • Mechanistic explanation:

    • SLC25A32 functions as a mitochondrial FAD transporter

    • FAD is derived from riboflavin and is an essential cofactor for:

      • Mitochondrial flavoproteins involved in fatty acid β-oxidation

      • Respiratory chain complexes

    • Riboflavin supplementation likely increases the FAD pool, allowing some transport through alternate mechanisms or enhancing residual SLC25A32 activity

  • Mouse model evidence:

    • Y174C/Y174C and K235R/K235R mice present with mild motor impairment

    • These models recapitulate the biochemical disturbances seen in patients

    • Provide valuable systems for testing therapeutic interventions

This connection highlights how defects in a single transporter can manifest as exercise intolerance through disruption of multiple mitochondrial metabolic pathways.

How does the metabolic environment modify the phenotypic consequences of Slc25a32 deficiency?

The metabolic environment significantly modifies Slc25a32 deficiency phenotypes through multiple mechanisms:

  • Substrate availability effects:

    • In galactose media, SLC25A32 knockout cells show improved fitness despite their defect

    • This buffering effect appears related to substrate limitation in de novo purine biosynthesis

    • Suggests metabolic environment can bypass certain consequences of Slc25a32 deficiency

  • Carbon source dependency:

    • SLC25A32 KO cells show growth defects in glucose, antimycin and -pyruvate conditions

    • These defects are buffered in galactose conditions

    • This unexpected finding challenges the traditional view of SLC25A32 as exclusively an FAD transporter, since cells grown in galactose rely heavily on mitochondrial respiration

  • Formate availability:

    • Slc25a32-/- embryos have reduced glycine-derived formate production

    • Formate supplementation increases folate levels and ameliorates NTDs

    • This effect is not restricted to specific Slc25a32 mutants, suggesting a broader metabolic interaction

  • Dimethylglycine accumulation:

    • Different Slc25a32 mutations cause unique metabolic signatures

    • Y174C/Y174C and K235R/K235R mice accumulate dimethylglycine, a formate donor

    • This creates different metabolic compensation mechanisms depending on the specific mutation

These observations highlight how nutritional and metabolic context can profoundly influence the consequences of genetic defects in folate transport, suggesting potential for metabolic interventions tailored to specific mutations.

What are the most promising approaches for studying potential redundant transport mechanisms for FAD in mitochondria?

Several promising approaches can be employed to study redundant FAD transport mechanisms in mitochondria:

  • Combinatorial genetic screens:

    • Apply dual Cas9 enzyme-based knockout strategies to probe all 53 human SLC25 family members

    • Screen for genetic interactions across different metabolic conditions (glucose, galactose, antimycin, -pyruvate)

    • Identify transporters with overlapping or compensatory functions

  • Metabolic flux analysis:

    • Use isotope-labeled riboflavin to track FAD transport into mitochondria

    • Compare flux in wild-type versus Slc25a32-deficient models

    • Identify residual transport activity that might indicate alternate pathways

  • Mitochondrial proteomics:

    • Perform comprehensive proteomic analysis of mitochondrial membrane proteins

    • Look for upregulation of alternative transporters in Slc25a32-deficient models

    • Identify candidate proteins for functional validation

  • In vitro transport assays:

    • Reconstitute purified mitochondrial carrier proteins in liposomes

    • Test their ability to transport FAD

    • Quantify transport kinetics and substrate specificity

  • Evolutionary analysis:

    • Compare FAD transport mechanisms across species, particularly in organisms lacking clear Slc25a32 homologs

    • Identify evolutionarily distinct solutions to mitochondrial FAD transport

    • Use this information to identify candidate alternative transporters in mammals

These approaches would help resolve the paradox observed in Slc25a32 knockout cells, which show normal respiratory function in galactose media despite the presumed importance of FAD transport for respiratory chain activity .

What is the relationship between mitochondrial FAD transport and folate metabolism, and how might this inform therapeutic strategies?

The complex relationship between mitochondrial FAD transport and folate metabolism presents several therapeutic opportunities:

  • Integrated metabolic network:

    • FAD deficiency affects dihydrolipoamide dehydrogenase (DLDH), a component of the glycine cleavage system

    • This leads to glycine accumulation and reduced formate production

    • Formate is essential for folate-mediated one-carbon metabolism (FOCM)

    • Thus, FAD transport defects indirectly disrupt folate metabolism

  • Therapeutic implications:

    • Targeted supplementation approaches:

      SupplementPrimary TargetSecondary EffectsPotential Applications
      RiboflavinIncreases FAD poolEnhances flavoenzyme functionRREI, exercise intolerance
      FormateBypasses glycine cleavage defectRestores FOCMNTD prevention
      FolatesDirect FOCM substratePartial compensation for transport defectCombined with other approaches
      Glycine-restricting dietReduces toxic accumulationMight alter one-carbon unit availabilityAdvanced cases with glycine elevation
  • Personalized approaches:

    • Different Slc25a32 mutations create unique metabolic signatures

    • Y174C/Y174C and K235R/K235R mice accumulate dimethylglycine

    • Y174C/K235R mice accumulate glycine

    • This suggests that therapeutic approaches might need to be tailored to specific mutations

  • Combined interventions:

    • The interconnected nature of these pathways suggests that combined supplementation strategies targeting multiple metabolic nodes may be more effective than single interventions

    • For example, riboflavin + formate supplementation may address both primary and secondary metabolic disturbances

Understanding this relationship has already informed successful therapeutic approaches for riboflavin-responsive exercise intolerance and suggests potential strategies for preventing neural tube defects in at-risk pregnancies .

How should researchers design experiments to distinguish between the folate transport and FAD transport functions of Slc25a32?

Designing experiments to distinguish between folate and FAD transport functions requires multilayered approaches:

  • In vitro transport assays:

    • Reconstitute purified Slc25a32 protein in liposomes

    • Measure transport kinetics for THF derivatives and FAD separately

    • Determine competitive inhibition patterns between substrates

    • Use site-directed mutagenesis to identify residues specific to each transport function

  • Rescue experiments:

    • Design complementation assays using:

      • FAD transport-deficient yeast (Δflx1)

      • Folate transport-deficient models

      • Measure rescue efficiency with wild-type and mutant Slc25a32 variants

  • Metabolic labeling studies:

    • Use isotope-labeled folates and riboflavin derivatives

    • Track their mitochondrial import in wild-type versus mutant cells

    • Measure conversion to active metabolites

  • Structure-function analysis:

    • Compare the binding affinity of Slc25a32 for folate derivatives versus FAD

    • Identify mutations that selectively impair one transport function while preserving the other

    • Use these to develop function-specific mouse models

  • Metabolomic profiling under variable conditions:

    • Measure mitochondrial and cytosolic pools of folates and FAD

    • Compare profiles between:

      • Wild-type

      • Complete Slc25a32 knockout

      • Folate-specific transport mutants

      • FAD-specific transport mutants

    • Include varying media conditions (glucose vs. galactose)

These approaches would help resolve the current ambiguity about the primary physiological function of Slc25a32 and explain the seemingly contradictory observations in different experimental systems .

What are the broader implications of Slc25a32 research for understanding mitochondrial transport mechanisms?

Research on Slc25a32 has significant implications for understanding mitochondrial transport mechanisms:

  • Transport redundancy and specificity:

    • The apparent ability of cells to compensate for Slc25a32 loss under certain conditions suggests redundant transport mechanisms

    • This challenges the paradigm of strict substrate specificity for mitochondrial carriers

    • Points to a more integrated and flexible transport network than previously recognized

  • Metabolic context dependency:

    • The observation that Slc25a32 knockout phenotypes vary dramatically with metabolic environment highlights the dynamic nature of mitochondrial transport

    • Suggests mitochondrial transporters function within a responsive network rather than as isolated carriers

  • Dual-function transporters:

    • Evidence that Slc25a32 may transport both folate derivatives and FAD suggests that other mitochondrial carriers might have broader substrate specificity than currently recognized

    • This has implications for understanding and treating other mitochondrial transport disorders

These insights from Slc25a32 research provide a model for investigating other mitochondrial transporters and understanding their roles in integrating cellular metabolism across compartments, particularly in disease states and varying metabolic conditions.

What are the most critical unanswered questions about Slc25a32 that should guide future research priorities?

Critical unanswered questions about Slc25a32 that should guide future research include:

  • Substrate specificity resolution:

    • What is the primary physiological substrate of Slc25a32: folate derivatives, FAD, or both?

    • What are the binding sites and transport mechanisms for each substrate?

    • How is transport of different substrates regulated?

  • Alternative transport mechanisms:

    • What compensatory mechanisms allow cells to maintain mitochondrial FAD levels in Slc25a32-deficient conditions?

    • How do cells prioritize between folate and FAD transport when Slc25a32 function is limited?

  • Tissue-specific functions:

    • Why do neural tube defects and exercise intolerance emerge as primary phenotypes despite Slc25a32's ubiquitous expression?

    • Are there tissue-specific cofactors or regulatory mechanisms?

  • Therapeutic optimization:

    • What is the optimal combination and dosing of riboflavin, folate, and formate for different Slc25a32 mutations?

    • Can metabolic interventions completely prevent neural tube defects in Slc25a32-deficient pregnancies?

  • Evolutionary significance:

    • Why has a dual-function transporter for these critical metabolites been conserved?

    • What evolutionary pressures shaped the substrate specificity of Slc25a32?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.