Recombinant Mouse Mitochondrial import inner membrane translocase subunit Tim21 (Timm21)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline for your preparations.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Timm21; Tim21; Mitochondrial import inner membrane translocase subunit Tim21; TIM21-like protein, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
19-249
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Timm21
Target Protein Sequence
LGRQLLPHFVFTKACFKTQPLRWGLREQKITVQPRTVLRFTQKTFWTQGPDPRKAKEDST KQVSIRRNQREETGVSMSQKVREAGRDVSYLIVVLFGVGLTGGLLYAIFKELFFSSSPNI IYGKALGKCRTHPEVSFLMIVLGRRCASLLKPMLSCFSVFRSHSLMHFDPGTVSYIHFSV VLSAPASSGLRHPSYKTILNQNVAKRVESWQRLHLGHYIVYRIQGILCGPQ
Uniprot No.

Target Background

Function
Tim21 participates in the translocation of transit peptide-containing proteins across the mitochondrial inner membrane. It is also essential for the assembly of mitochondrial respiratory chain complex I and complex IV as a component of the MITRAC (mitochondrial translation regulation assembly intermediate of cytochrome c oxidase complex). Tim21 likely shuttles between the presequence translocase and respiratory-chain assembly intermediates, facilitating the incorporation of early nuclear-encoded subunits into these complexes.
Database Links
Protein Families
TIM21 family
Subcellular Location
Mitochondrion membrane; Single-pass membrane protein.

Q&A

What is the function of mouse Timm21 in mitochondrial protein import?

Mouse Timm21 (Translocase of Inner Mitochondrial Membrane 21) plays a crucial role in the translocation of transit peptide-containing proteins across the mitochondrial inner membrane. It participates in the assembly of mitochondrial respiratory chain complexes, particularly Complex I and Complex IV. Based on research across different organisms, Timm21 serves as a dynamic connector between protein import machinery and respiratory chain assembly in mitochondria . Specifically, it appears to shuttle between the presequence translocase and respiratory-chain assembly intermediates, promoting the incorporation of early nuclear-encoded subunits into these complexes. This dual functionality makes Timm21 essential for coordinating mitochondrial biogenesis and respiratory function.

What protein complexes does Timm21 interact with?

Timm21 interacts with multiple protein complexes within mitochondrial membranes, positioning it as a key coordinator of mitochondrial functions. These interactions include:

ComplexInteraction EvidenceFunctionReference
TIM17:23 translocaseBlue Native PAGE, Y2HInner membrane protein import
Respiratory Complex IBlue Native PAGEElectron transport chain
Respiratory Complex IIIBlue Native PAGEElectron transport chain
Complex I/III supercomplexBlue Native PAGERespiratory chain integration
OCIAD1Co-immunoprecipitationRegulation of translocase stability
Prohibitin complexGenetic studiesProtection from YME1L protease

These interactions suggest that Timm21 serves as a bridge between the protein import machinery and the respiratory chain complexes, potentially coordinating mitochondrial biogenesis and function .

How is Timm21 localized within the mitochondria?

Timm21 is primarily localized to the inner mitochondrial membrane. Import assays and GFP targeting studies have confirmed this localization. Specifically, Timm21 is integrally located within the inner membrane, with no shift observed following protease treatment of ruptured mitochondria . This suggests that the protein is not significantly exposed to the intermembrane space side of the inner membrane. Within the inner membrane, Timm21 associates with the TIM23 complex and can dynamically interact with respiratory chain complexes. This strategic localization is essential for its proposed role as a shuttle between different mitochondrial complexes, facilitating both protein import and respiratory chain assembly processes .

How do mutations in Timm21 affect mitochondrial function and respiratory chain assembly?

Mutations in Timm21 can significantly impact mitochondrial function and respiratory chain assembly. From studies in other systems, we know that Timm21 plays a critical role in the assembly of respiratory chain complexes. In Arabidopsis, deletion of AtTim21 results in early seedling lethality, unlike in yeast where it's non-essential . Overexpression of AtTim21 in Arabidopsis led to increased cell numbers, cell size, and ATP production, with upregulation of complex III, IV, and ATP synthase subunits .

The human ortholog TIMM21 is associated with Optic Atrophy 12 and Combined Oxidative Phosphorylation Deficiency 29 , suggesting mutations particularly impact tissues with high energy demands. Mechanistically, Timm21 mutations likely disrupt the shuttle function between the presequence translocase and respiratory chain assembly intermediates, leading to defects in the incorporation of nuclear-encoded subunits into respiratory complexes, ultimately compromising oxidative phosphorylation and ATP production.

What is the role of Timm21 in the coordination between protein import and respiratory chain assembly?

Timm21 serves as a critical coordinator between protein import and respiratory chain assembly in mitochondria. Research demonstrates that Timm21 dynamically associates with both the TIM17:23 import complex and respiratory chain complexes I and III . This dual interaction capability allows Timm21 to shuttle between these complexes, facilitating the efficient incorporation of newly imported nuclear-encoded proteins into the respiratory chain .

The proposed mechanism involves:

  • Initial interaction with the TIM17:23 complex during protein import

  • Binding to respiratory chain assembly intermediates

  • Facilitating the incorporation of newly imported subunits into respiratory complexes

  • Shuttling back to the import machinery

This coordination is essential for efficient mitochondrial biogenesis and energy production. Studies in Arabidopsis showed that overexpression of Tim21 increased respiratory chain subunit expression and ATP production , further supporting its role in coordinating these processes.

How can recombinant Timm21 be used to study protein-protein interactions within the TIM23 complex?

Recombinant Timm21 provides a powerful tool for investigating protein-protein interactions within the TIM23 complex. Several approaches leveraging recombinant Timm21 can be employed:

ApproachMethodologyApplicationsAdvantages
Pull-down assaysAffinity-tagged recombinant Timm21Identification of direct interactorsAllows control of binding conditions
Crosslinking studiesChemical crosslinkers with purified componentsCapturing transient interactionsIdentifies proximity relationships
Surface plasmon resonanceImmobilized Timm21 with flowing partnersBinding kinetics, affinity measurementsQuantitative interaction parameters
Hydrogen-deuterium exchangeMass spectrometry of complexesConformational changes upon bindingStructural information on interactions
Reconstitution experimentsLiposomes with purified componentsFunctional testing of interactionsTests biological relevance

Research has utilized affinity-tagged versions of Timm21 to identify interactions with TIM17:23 complex components and respiratory chain complexes . For example, studies have shown that both FLAG-tagged TIMM23 and TIMM21 interact with OCIAD1, although with different efficiencies .

What structural features of Timm21 mediate its interactions with both the TIM complex and respiratory chain complexes?

  • A single transmembrane domain anchoring it to the inner mitochondrial membrane

  • A hydrophilic domain extending into the intermembrane space

  • Specific binding motifs or interaction surfaces for TIM complex components

  • Separate binding regions for respiratory chain complex subunits

The protein's ability to shuttle between complexes suggests it may undergo conformational changes that regulate these interactions. Studies in yeast identified interactions between Tim21 and both components of the TIM17:23 complex and respiratory subunits of complex III and IV (including cytochrome c1, Rieske Fe/S, and cox4) . Similarly, AtTim21 from Arabidopsis interacts with TIM17:23 complex and Complex III . Further structural biology approaches would be valuable for elucidating the precise structural determinants of these interactions.

How does the expression of Timm21 influence mitochondrial biogenesis and cellular ATP production?

The expression levels of Timm21 appear to have significant effects on mitochondrial biogenesis and cellular energy production. Evidence from Arabidopsis shows that overexpression of AtTim21 resulted in:

  • Increased cell numbers and cell size

  • Enhanced ATP production

  • Upregulation of complex III, IV, and ATP synthase subunit transcripts

These findings suggest that Timm21 may be a limiting factor in mitochondrial respiratory capacity and biogenesis. The mechanism likely involves Timm21's role in coordinating protein import with respiratory chain assembly, ensuring efficient incorporation of nuclear-encoded subunits into respiratory complexes. The relationship between Timm21 and mitochondrial biogenesis presents potential therapeutic opportunities for conditions characterized by mitochondrial dysfunction, particularly those affecting high-energy demand tissues.

What expression systems are optimal for producing functional recombinant mouse Timm21?

Producing functional recombinant mouse Timm21 requires careful consideration of expression systems to ensure proper folding, post-translational modifications, and biological activity:

Expression SystemAdvantagesDisadvantagesOptimization Strategies
E. coliHigh yield, cost-effective, rapidLacks post-translational modifications, inclusion body formationUse solubility tags (MBP, SUMO), low-temperature induction
Insect cellsBetter folding, some PTMs, moderate yieldMore expensive, longer production timeOptimize codon usage, use secretion signals
Mammalian cellsNative PTMs, proper foldingLower yield, expensive, time-consumingUse strong promoters, stable cell lines
Cell-free systemsRapid, avoids toxicity issuesLimited PTMs, higher costSupplement with chaperones, membrane mimetics

For structural and in vitro interaction studies, E. coli expression with proper solubility tags may be sufficient. For functional studies, mammalian or insect cell expression may be preferable to ensure proper folding and membrane integration. The cDNA ORF clones derived from mouse Timm21 are commercially available, providing a starting point for expression construct development . When producing recombinant Timm21, it's important to consider whether to express the full-length protein including the mitochondrial targeting sequence or just the mature protein.

How can Blue Native PAGE (BN-PAGE) be used to analyze Timm21 incorporation into mitochondrial complexes?

Blue Native PAGE (BN-PAGE) is a powerful technique for analyzing Timm21 incorporation into native mitochondrial protein complexes while preserving their structural integrity and interactions. This approach has successfully demonstrated that Timm21-like proteins associate with monomeric forms of Complex I and Complex III, as well as the supercomplex of Complexes I and III .

Key steps in utilizing BN-PAGE for Timm21 analysis include:

  • Mitochondrial isolation: Carefully isolate intact mitochondria using differential centrifugation

  • Membrane solubilization: Solubilize mitochondrial membranes with mild detergents (e.g., digitonin or n-dodecyl-β-D-maltoside)

  • Sample preparation: Add Coomassie Blue G-250 to provide negative charge without denaturing

  • Electrophoresis: Run samples on a gradient gel (typically 3-12% or 4-16%)

  • Detection methods:

    • For radiolabeled Timm21: Autoradiography or phosphorimaging

    • For endogenous Timm21: Western blotting with specific antibodies

    • For recombinant tagged Timm21: Antibodies against the tag

For advanced analyses, second-dimension SDS-PAGE can be performed after BN-PAGE to separate individual components of complexes containing Timm21, providing comprehensive mapping of Timm21's interactions.

What protein tagging strategies minimize interference with Timm21 function?

Selecting appropriate tagging strategies for Timm21 requires careful consideration to minimize functional interference while enabling detection and purification:

Tag TypePositionAdvantagesPotential IssuesExamples from Research
Small epitope tags (FLAG, HA, Myc)C-terminusMinimal interference, good antibodiesMay affect C-terminal interactionsTIMM23FLAG, TIMM21FLAG, HA-tagged TIMM17A/B
GFP/fluorescent proteinsC-terminusLive imaging, localization studiesLarger size may affect functionGFP targeting used for localization studies
PolyhistidineN-terminus (after MTS)Efficient purificationMay affect N-terminal interactionsOften used with additional cleavage sites
Split tags (SpyTag/SpyCatcher)Internal permissive sitesMinimal structural disruptionRequires structural knowledgeEmerging approach for membrane proteins
Biotin acceptor peptideC-terminusHighly specific streptavidin bindingRequires biotin ligase co-expressionUseful for proximity labeling approaches

Research has successfully utilized FLAG-tagged TIMM21 and TIMM23 to study interactions with OCIAD1 , and HA-tagged TIMM17A and TIMM17B have been used to study Tim21 associations . For in vitro import assays, adding three additional methionines at the N-terminus has been employed to enhance radiolabeling . When tagging Timm21, it's crucial to verify that the tagged protein localizes correctly and retains functionality.

What methods can be used to assess the impact of Timm21 on mitochondrial membrane potential?

Assessing the impact of Timm21 on mitochondrial membrane potential requires complementary approaches:

MethodPrincipleAdvantagesLimitationsData Analysis
JC-1 dyeRatio of red/green fluorescenceRatiometric, semi-quantitativeTemperature sensitiveFlow cytometry or microscopy
TMRM/TMREAccumulation proportional to potentialQuantitative, real-timePhotobleaching, toxicityFluorescence intensity measurement
Rhodamine 123Non-quenching mode fluorescenceLess toxicityLess sensitive than TMRMQuantify fluorescence retention
Potentiometric electrodesDirect electrical measurementDirect physical measurementRequires isolated mitochondriaCalculate membrane potential in mV
Patch-clampDirect measurement of ionic currentsSingle mitochondrion resolutionTechnically challengingAnalyze current-voltage relationship

For Timm21 functional studies, comparing membrane potential in wild-type versus Timm21-depleted or -overexpressing mitochondria would provide insights into its role in maintaining mitochondrial function. Since Timm21 participates in both protein import (which consumes membrane potential) and respiratory chain assembly (which generates membrane potential), these measurements can reveal its net impact on mitochondrial energetics.

How can CRISPR/Cas9 be used to study Timm21 function in vivo?

CRISPR/Cas9 technology offers powerful approaches for studying Timm21 function in vivo through precise genetic manipulation:

CRISPR ApplicationStrategyResearch Questions AddressedConsiderations
Complete knockoutDelete entire geneEssential functions, null phenotypeMay be lethal based on ortholog data
Conditional knockoutFloxed allele with tissue-specific CreTissue-specific functionsRequires careful timing and specificity
Domain mutationsEdit specific domainsStructure-function relationshipsRequires knowledge of domain architecture
Tagged endogenous proteinKnock-in fluorescent or epitope tagsLocalization, interaction partnersMust verify tag doesn't impair function
Promoter modulationEdit regulatory regionsExpression regulationRequires regulatory element knowledge
Base editingSingle amino acid changesTest specific residue functionsLimited to certain mutation types

For Timm21, conditional approaches may be necessary if complete knockout is lethal. Tissue-specific deletion in high-energy demand tissues (brain, heart, muscle) could reveal its importance in different physiological contexts. Domain-specific mutations could separate Timm21's functions in protein import from its role in respiratory chain assembly.

How do you troubleshoot low incorporation of recombinant Timm21 into mitochondrial membranes?

Troubleshooting low incorporation of recombinant Timm21 into mitochondrial membranes requires a systematic approach:

ProblemPossible CausesDiagnostic ApproachSolution Strategies
Poor targetingDamaged targeting sequenceCompare sequence with wild-typeRestore correct targeting sequence
Improper N-terminal processingWestern blot for size comparisonOptimize N-terminal design
Incorrect foldingExpression conditionsTest different induction temperaturesLower expression temperature
Lack of chaperonesCo-expression with mitochondrial chaperonesAdd chaperone proteins to system
Membrane saturationExcessive expressionTitrate expression levelsUse inducible promoters
Limited membrane spaceIncrease mitochondrial biogenesisPretreat with AICAR or other activators
Import machinery limitationsTIM complex saturationAnalyze TIM complex componentsCo-express limiting TIM components
Protein aggregationHydrophobic domain exposureDetergent screeningOptimize detergent type and concentration
Improper disulfide formationRedox environment modificationAdd appropriate redox buffers

Research has shown that adding three additional methionines at the N-terminus for in vitro transcription and translation can affect the intensity of the mature protein band after import . Similarly, the proper function of import machinery components like OCIAD1 and prohibitins is important for the stability of TIM complex components .

What controls are essential when studying Timm21 interactions with respiratory complexes?

When studying Timm21 interactions with respiratory complexes, robust controls are essential to ensure specificity and physiological relevance:

Essential controls include:

  • Negative controls:

    • Non-interacting mitochondrial proteins (matrix or outer membrane proteins)

    • Mutated Timm21 with disrupted interaction domains

    • Detergent-only controls for non-specific binding

  • Specificity controls:

    • Competition with excess untagged Timm21

    • Reciprocal co-immunoprecipitation (IP Timm21, detect complexes; IP complexes, detect Timm21)

    • Gradient fractionation to confirm co-migration

  • Functional validation:

    • Respiratory complex activity measurements with and without Timm21

    • Assembly kinetics of respiratory complexes with altered Timm21 levels

    • In vitro reconstitution with purified components

  • Technical controls:

    • Input samples to calculate pull-down efficiency

    • Loading controls for normalization

    • Antibody specificity verification

Research has shown that Timm21 associates with both the TIM17:23 complex and respiratory chain complexes I and III . When investigating these interactions, it's important to use approaches like Blue Native PAGE that preserve native protein interactions.

How do you differentiate between direct and indirect effects of Timm21 manipulation?

Differentiating between direct and indirect effects of Timm21 manipulation requires multiple complementary approaches:

ApproachMethodologyAdvantagesLimitations
Acute vs. chronic depletionsiRNA vs. stable knockoutSeparates immediate from adaptive responsesDifferent efficiencies of depletion
Rescue experimentsRe-expression of wild-type or mutant Timm21Confirms specificity of observed phenotypesMay not restore all functions
Domain-specific mutationsStructure-guided mutagenesisSeparates different functionsRequires structural knowledge
In vitro reconstitutionPurified components in liposomesTests direct biochemical activitiesMay miss cellular context
Proximity labelingBioID or APEX2 fusionsIdentifies proximal proteins in vivoCannot prove functional relationship
Temporal analysisTime-course experimentsEstablishes sequence of eventsComplex data interpretation

For Timm21, it's important to consider its dual roles in protein import and respiratory chain assembly. Direct effects would include immediate changes to protein import efficiency or respiratory complex assembly, while indirect effects might include broader changes to mitochondrial function, cellular energy status, or retrograde signaling to the nucleus.

What statistical approaches are recommended for analyzing Timm21 knockout phenotypes?

Statistical ApproachApplicationAdvantagesConsiderations
Student's t-testCompare two groups (WT vs. KO)Simple, well-establishedAssumes normal distribution
ANOVA with post-hoc testsMultiple group comparisonsAccounts for multiple comparisonsRequires homogeneity of variance
Non-parametric testsNon-normally distributed dataNo normality assumptionMay have less power
Mixed-effects modelsRepeated measures, multiple factorsAccounts for biological variabilityMore complex interpretation
Survival analysisViability phenotypesAccounts for time-to-event dataRequires appropriate censoring
Multivariate analysisMultiple related outcomesAccounts for correlationsComplex interpretation
Power analysisExperimental designEnsures adequate sample sizeRequires effect size estimation

For Timm21 studies, considering that deletion of related proteins like AtTim21 in Arabidopsis results in early seedling lethality , embryonic phenotypes may require specialized approaches. Additionally, for complex phenotypes involving mitochondrial function, respiratory chain activity, and ATP production, multivariate approaches may be necessary to capture the relationships between these interrelated parameters.

How can conflicting data about Timm21 interactions be reconciled?

Reconciling conflicting data about Timm21 interactions requires careful analysis of experimental conditions and biological context:

Source of ConflictAnalytical ApproachResolution StrategyExamples from Research
Different model organismsPhylogenetic analysisConsider evolutionary divergenceCompare yeast, plant, and mammalian Tim21
Experimental conditionsSystematic parameter testingIdentify condition-dependent interactionsSolubilization methods affect complex integrity
Detection methodsMethod comparison studiesDetermine method-specific limitationsIn vivo vs. in vitro approaches
Static vs. dynamic interactionsTime-resolved experimentsCapture temporal interaction changesTim21 shuttles between complexes
Direct vs. indirect interactionsProximity analysisMap interaction networksOCIAD1 interactions with TIM complex
Tissue-specific differencesTissue-specific analysesCharacterize tissue-dependent variationHigh vs. low energy demand tissues

Research has shown that Tim21 can dynamically associate with multiple complexes, including the TIM17:23 complex and respiratory chain complexes I and III . This shuttling behavior might explain seemingly conflicting results if different studies capture Tim21 in different states or complexes. For example, both TIMM23FLAG and TIMM21FLAG interact with OCIAD1, but with different efficiencies , highlighting the importance of using multiple complementary methods.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.