Recombinant Mouse Mitochondrial import inner membrane translocase subunit TIM50 (Timm50)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
Timm50; Tim50; Mitochondrial import inner membrane translocase subunit TIM50
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
22-353
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Timm50
Target Protein Sequence
LCTRLAPPPPRTPEQVTEIANRGGSKAQGPQHQPGSEGPSYAKKIALWIAGLLGAGGTVS IVYIFGNNPVDENGTKIPDEFDSDPILVQQLRRTYKYFKDYRQMIIEPTSPCLLPDPLRE PYYQPPYTLVLELTGVLLHPEWSLATGWRFKKRPGIETLFQQLAPLYEIVIFTSETGMTA FPLIDSVDPHGFISYRLFRDATRYMEGHHVKDISCLNRDPARVVVVDCKKEAFRLQPFNG VALRPWDGNSDDRVLLDLSAFLKTIALNQVEDVRTVLEHYALEDDPLEAFKQRQSRLEQE EQQRLAELSKSNRQGLSFGSLASRLWPRSKQP
Uniprot No.

Target Background

Function
An essential component of the TIM23 complex, this protein mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane. While exhibiting in vitro phosphatase activity, its in vivo relevance remains unclear.
Gene References Into Functions
  1. TIM50 deficiency in mice resulted in increased heart and cardiomyocyte size with exacerbated cardiac fibrosis compared to wild-type littermates. Cardiomyocyte-specific TIM50 transgenic mice showed alleviation of these hypertrophic and fibrotic phenotypes. PMID: 28432072
Database Links
Protein Families
TIM50 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

Basic Research Questions

  • What is the function of TIM50 in mitochondria?

    TIM50 serves as the receptor component of the TIM23 complex, which mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane . Methodologically, functional studies in various organisms including yeast and T. brucei have demonstrated that TIM50 maintains the permeability barrier of the mitochondrial inner membrane (MIM) and is required for mitochondrial protein import . Research approaches to study TIM50 function typically include genetic knockdown/knockout experiments, followed by evaluation of mitochondrial membrane potential and protein import efficiency. Biochemical analysis reveals that TIM50 interacts directly with TIM23, functioning as a critical component necessary for proper translocation of nuclear-encoded mitochondrial proteins .

  • How is TIM50 involved in protein import into mitochondria?

    TIM50 functions specifically in the import of N-terminal signal-containing nuclear-encoded mitochondrial proteins, but not internal signal-containing proteins . Methodologically, this specificity can be demonstrated through in vitro protein import assays using TIM50 knockdown models. After presequence transfer from the TOM40 complex to TIM50, the precursor protein guided by the presequence enters the TIM23 channel . Experimental approaches reveal that TIM50 selectively facilitates the passage of proteins with specific targeting signals, cooperating with other components of the mitochondrial import machinery to ensure proper protein localization . Substrate specificity studies across different eukaryotes indicate this function is evolutionarily conserved .

  • What are the structural domains of TIM50 and their functions?

    TIM50 contains multiple functional domains including a transmembrane domain (TMD) and two distinct domains in the intermembrane space (IMS): a core domain and a presequence-binding domain (PBD) . Methodologically, researchers analyze these domains by creating truncation variants (e.g., Tim50(1–365) lacking PBD and Tim50(366–476) containing only PBD) and performing functional complementation studies . Both domains have been shown to be essential for cell viability but serve distinct roles. The core domain primarily mediates recruitment to the TIM23 complex, while the PBD has a separate function . Together, these domains coordinate the translocation of proteins across both mitochondrial membranes, as demonstrated through domain-specific mutation and functional analysis studies.

  • What experimental approaches are used to study TIM50 function?

    Multiple complementary approaches are employed to investigate TIM50 function. These include: (1) In vitro protein import assays with isolated mitochondria from TIM50 knockdown/overexpression models to assess protein translocation efficiency ; (2) Co-immunoprecipitation experiments to identify interacting proteins and complexes ; (3) Yeast two-hybrid analysis to study direct protein-protein interactions ; (4) Generation of knockout and transgenic mouse models to investigate in vivo functions ; (5) Site-directed mutagenesis to analyze specific functional residues ; and (6) Mitochondrial membrane potential measurements to assess the integrity of the inner membrane . These methodological approaches collectively provide a comprehensive understanding of TIM50's diverse functions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.