Recombinant Mouse Mitochondrial inner membrane protease subunit 2 (Immp2l)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Immp2l; Mitochondrial inner membrane protease subunit 2; IMP2-like protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-175
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Immp2l
Target Protein Sequence
MAQSQSWARRCFKAFCKGFFVAVPVAVTFLDRVACVARVEGSSMQPSLNPGGSQSSDVVL LNHWKVRNFEVQRGDIVSLVSPKNPEQKIIKRVIALEGDIVRTIGHKNRLVKVPRGHMWV EGDHHGHSFDSNSFGPVSLGLLHAHATHILWPPERWQRLESVLPPERCPLQTGEK
Uniprot No.

Target Background

Function
This enzyme catalyzes the removal of transit peptides essential for targeting proteins from the mitochondrial matrix, across the inner membrane, and into the intermembrane space. It is known to process the nuclear-encoded protein DIABLO.
Gene References Into Functions
  • IMP2 deficiency delays bone remodeling by significantly inhibiting osteoclast activity and impairing their adhesion. PMID: 29322325
  • Data suggest that respiratory deficiency is not responsible for the observed Immp2l mutant phenotypes. PMID: 25460737
  • Evidence supports a causal role for oxidative stress in the neurodegeneration observed in Immp2l mutant mice. PMID: 26616244
  • IMP2 functions as a developmentally regulated factor influencing the differentiation potential of neural progenitor cells in the mouse neocortex. PMID: 23331702
  • Immp2l deficiency exacerbates ischemic brain damage by increasing O2- production and impairing mitochondrial function. PMID: 21824519
  • Mitochondrial peptidase IMMP2L mutations lead to early-onset age-associated disorders and impaired adult stem cell self-renewal. PMID: 21332923
Database Links
Protein Families
Peptidase S26 family, IMP2 subfamily
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is Immp2l and what is its primary function in mitochondria?

Immp2l (Inner mitochondrial membrane peptidase subunit 2) is an enzyme that functions as a subunit of the mitochondrial inner membrane peptidase complex. This complex plays a critical role in processing proteins targeted to the mitochondria by cleaving transit peptides required for the movement of proteins from the mitochondrial matrix, across the inner membrane, into the intermembrane space . In mice, Immp2l has two key known substrates: cytochrome c1 and mitochondrial glycerol phosphate dehydrogenase 2. When functioning properly, it cleaves the intermembrane space-sorting signals from precursor or intermediate polypeptides after they reach the inner membrane or intermembrane space .

Methodologically, researchers typically confirm Immp2l function through western blot analysis of substrate processing, comparing wild-type and Immp2l-deficient mitochondria to observe differences in protein migration patterns due to incomplete processing.

How does Immp2l processing differ from other mitochondrial peptidases?

Unlike the mitochondrial processing peptidase (MPP) that primarily cleaves N-terminal targeting sequences, Immp2l demonstrates distinct processing activity. Research has revealed that Immp2l can process C-terminal sequences, as evidenced in studies of the TIM23 complex subunit Mgr2. While MPP removes matrix-targeting signals at the N-terminus, Immp2l has been shown to cleave C-terminal targeting sequences that would otherwise impair stable assembly and function of protein complexes in the mitochondrial inner membrane .

To distinguish between MPP and Immp2l processing experimentally, researchers can use mutant strains (mas1-mutant for MPP deficiency and imp1Δ for Imp1 deficiency) and compare protein processing patterns. Processing that occurs normally in mas1-mutant mitochondria but is impaired in imp1Δ mitochondria indicates Immp2l-specific processing .

What are the most effective methods for generating Immp2l knockdown or knockout mouse models?

Several effective approaches have been used to generate Immp2l-deficient mouse models:

  • Gene Mutation Models: The Immp2l Tg(Tyr)979Ove/Immp2l mouse model contains a mutation in the Immp2l gene and has been valuable for studying the effects of impaired Immp2l function .

  • Knockdown Approach: For partial reduction of gene expression, Immp2l knockdown has been achieved through RNA interference techniques. This approach allows researchers to study the effects of reduced but not abolished Immp2l expression, which may better model certain human conditions where the gene is present but functioning abnormally .

When designing these models, researchers should consider:

  • Verification of knockdown/knockout efficiency through protein and mRNA quantification

  • Assessment of substrate processing efficiency (cytochrome c1 and glycerol phosphate dehydrogenase 2)

  • Confirmation of phenotypic manifestations (ROS levels, age-associated changes)

The choice between knockout and knockdown approaches should be guided by the specific research question, as complete absence versus partial reduction of Immp2l can produce different phenotypes.

How can researchers effectively measure mitochondrial ROS production in Immp2l-deficient models?

Quantifying mitochondrial ROS production in Immp2l-deficient models requires multiple complementary approaches:

When interpreting results, researchers should note that increased expression of antioxidant enzymes does not necessarily indicate reduced oxidative stress, as Immp2l mutants show elevated oxidative stress despite increased SOD1/SOD2 expression .

What is the evidence linking Immp2l dysfunction to neurodevelopmental disorders?

Immp2l has been implicated in several neurodevelopmental disorders, most notably autism spectrum disorder (ASD) and Gilles de la Tourette syndrome (GTS). The evidence comes from multiple lines of research:

  • Genetic Association: The human IMMP2L gene located at chromosome band 7q31 has been associated with these conditions in genetic studies .

  • Behavioral Phenotyping: Immp2l knockdown mice have demonstrated behavioral alterations relevant to ASD and GTS, particularly increased responsiveness to auditory stimuli paired with food rewards. This suggests that Immp2l may contribute to an increased capacity for external stimuli to drive behavior, potentially influencing the expression of tics and repetitive behaviors characteristic of these disorders .

  • Neurological Findings: While gross neuroanatomical changes (neuron density in striatum, prefrontal cortex, or limbic structures) were not observed in Immp2l KD mice, the functional behavioral alterations suggest more subtle changes in neuronal connectivity or function .

Researchers investigating this connection should employ comprehensive behavioral testing batteries that include measures of repetitive behaviors, social interaction, and sensory sensitivity, alongside neurophysiological assessments.

How does Immp2l mutation contribute to accelerated aging phenotypes?

Immp2l mutation leads to accelerated aging through several interrelated mechanisms:

  • Elevated Mitochondrial ROS: Immp2l mutation impairs the signal peptide processing of its substrates (cytochrome c1 and glycerol phosphate dehydrogenase 2), resulting in mitochondria that generate elevated levels of superoxide ion .

  • Increased Cellular Oxidative Stress: Despite compensatory upregulation of antioxidant enzymes (SOD1 and SOD2), mutant mice exhibit elevated oxidative stress markers in multiple tissues, including the brain and kidney .

  • Temporal Progression: Mutant mice appear normal in development, locomotion, and social behavior before 16 months of age, but subsequently exhibit multiple signs of accelerated aging. This age-dependent manifestation supports the cumulative nature of oxidative damage .

  • Sex-Specific Effects: Female Immp2l mutants show more pronounced phenotypes than males, suggesting hormonal or sex-specific metabolic factors may interact with the primary mitochondrial dysfunction .

Researchers studying these aging effects should employ longitudinal designs with regular assessment timepoints and include both sexes to capture the full spectrum of phenotypic changes.

How do alterations in Immp2l function affect the TIM23 complex and broader mitochondrial import machinery?

The relationship between Immp2l and the TIM23 complex reveals sophisticated regulatory mechanisms in mitochondrial protein import:

  • Structural Alterations: Research has shown that the TIM23 complex (presequence translocase of the inner mitochondrial membrane) is structurally altered in mitochondria lacking IMP subunits .

  • Mgr2 Processing: A key finding is that the TIM23 subunit Mgr2 undergoes C-terminal processing by IMP (specifically Imp1), which is essential for proper assembly and function of the TIM23 complex .

  • Novel Processing Mechanism: Unlike conventional N-terminal processing, IMP removes a C-terminal targeting sequence from Mgr2 that would otherwise impair stable assembly of the mature TIM23 complex .

This interconnection suggests that Immp2l dysfunction may have broader consequences for mitochondrial protein import beyond its direct substrates. When investigating these effects, researchers should employ techniques such as:

  • Blue native PAGE to analyze protein complex integrity

  • Co-immunoprecipitation to assess protein-protein interactions within the import machinery

  • In vitro import assays using radiolabeled precursor proteins to quantify import efficiency

  • Electron microscopy to visualize structural alterations in mitochondrial membrane complexes

What are the contradictions in ROS signaling effects between Immp2l mutation models and other ROS-related pathways?

Several intriguing contradictions have emerged in Immp2l research regarding ROS effects:

These contradictions highlight the complexity of ROS signaling and emphasize the need for nuanced experimental approaches that consider:

  • The distinction between physiological ROS signaling and pathological oxidative stress

  • The timing and localization of ROS production

  • The specific molecular targets of oxidative modification

  • Compensatory mechanisms that may mask or modulate primary effects

How can researchers effectively measure the impact of Immp2l dysfunction on goal-directed versus stimulus-driven behaviors?

Based on recent findings linking Immp2l to behavioral alterations, researchers should implement the following methodological approaches:

  • Instrumental Learning Paradigms: Use procedures that specifically examine response-outcome and stimulus-response associations. These procedures have successfully demonstrated that Immp2l KD mice show normal goal-directed learning (as measured by sensitivity to outcome devaluation and contingency degradation) but enhanced responsiveness to external stimuli .

  • Pavlovian-to-Instrumental Transfer (PIT): This procedure is particularly valuable for assessing how environmental cues influence ongoing instrumental behavior. Immp2l KD mice showed non-specific increases in lever response rates during PIT, indicating heightened susceptibility to cue-driven behavior .

  • Habit Formation Assessment: Extended training protocols can be used to test the capacity to form habitual behaviors. Current evidence suggests Immp2l KD mice form habits similarly to wild-type mice .

  • Behavioral Control Measures: Include assessments of general locomotor activity, anxiety-like behavior, and sensorimotor gating to contextualize specific findings regarding goal-directed and stimulus-driven behaviors.

When implementing these approaches, researchers should:

  • Use appropriate sample sizes based on power calculations

  • Include both sexes to identify potential sex differences

  • Consider developmental timing by testing animals at multiple age points

  • Correlate behavioral findings with molecular and cellular measures

What neuroanatomical and neurophysiological changes should researchers investigate in Immp2l-deficient models?

While initial studies found no alterations in neuron density in striatum or prefrontal cortex structures in Immp2l KD mice , more sensitive analyses may reveal subtle changes:

  • Synaptic Structure and Function:

    • Electron microscopy to assess synaptic density and morphology

    • Electrophysiological recordings to measure synaptic transmission and plasticity

    • Measurement of neurotransmitter levels and receptor expression

  • Circuit-Level Analyses:

    • Functional connectivity using techniques like optogenetics or chemogenetics

    • Calcium imaging to measure neuronal activity patterns

    • In vivo electrophysiological recordings during behavioral tasks

  • Molecular Signaling Pathways:

    • Analysis of oxidative stress markers in specific neuronal populations

    • Assessment of mitochondrial function in different brain regions

    • Examination of inflammatory markers that might be secondary to oxidative stress

  • Neurodevelopmental Trajectories:

    • Time-course analysis of brain development in Immp2l-deficient models

    • Critical period manipulations to determine windows of vulnerability

    • Rescue experiments to assess the reversibility of observed phenotypes

These investigations should focus particularly on cortico-striatal circuits implicated in repetitive behaviors and sensory processing, as these are relevant to the behavioral phenotypes observed in Immp2l KD mice .

What therapeutic approaches might target Immp2l-related pathways in aging and neurodevelopmental disorders?

Based on current understanding of Immp2l function, several promising therapeutic approaches warrant investigation:

  • Mitochondrial ROS Modulators:

    • Mitochondria-targeted antioxidants (e.g., MitoQ, SS-31)

    • Activation of endogenous antioxidant pathways (e.g., Nrf2 activators)

    • Mitochondrial uncouplers at low doses to reduce ROS production

  • Substrate Processing Enhancement:

    • Small molecules that promote proper folding of Immp2l substrates

    • Peptide mimetics that facilitate substrate recognition

    • Gene therapy approaches to restore normal Immp2l function

  • Behavioral Interventions:

    • For neurodevelopmental phenotypes, interventions targeting the heightened stimulus-driven behavior observed in Immp2l KD mice

    • Cognitive-behavioral approaches to reduce the impact of sensory hypersensitivity

  • Metabolic Interventions:

    • Dietary approaches (caloric restriction, ketogenic diet) that may compensate for mitochondrial dysfunction

    • Exercise protocols that promote mitochondrial biogenesis and function

Research should progress from preclinical models to careful biomarker studies in human populations with IMMP2L mutations or variants before clinical trials of targeted therapeutics.

How might Immp2l function integrate with other mitochondrial quality control mechanisms?

Immp2l likely interacts with broader mitochondrial quality control networks in ways that remain to be fully elucidated:

  • Mitophagy Pathways:

    • Investigation of how Immp2l dysfunction affects PINK1/Parkin-mediated mitophagy

    • Assessment of mitochondrial turnover rates in Immp2l-deficient cells

  • Unfolded Protein Response (UPRmt):

    • Analysis of whether Immp2l deficiency triggers compensatory UPRmt signaling

    • Exploration of temporal relationships between protein processing defects and stress responses

  • Mitochondrial Dynamics:

    • Quantification of fusion/fission balance in Immp2l-deficient mitochondria

    • Live-cell imaging of mitochondrial network dynamics

  • Crosstalk with Other Organelles:

    • Investigation of mitochondria-ER contacts and calcium signaling

    • Assessment of peroxisomal function given shared roles in redox regulation

These interconnections may explain why some expected phenotypes of Immp2l dysfunction (such as increased tumorigenesis) are not observed and could reveal compensatory mechanisms that might be therapeutically exploited.

What are the optimal conditions for expressing and purifying recombinant mouse Immp2l for in vitro studies?

For successful expression and purification of functional recombinant mouse Immp2l:

  • Expression Systems:

    • Prokaryotic: E. coli BL21(DE3) with membrane protein-optimized strains

    • Eukaryotic: Insect cells (Sf9, High Five) generally provide better folding for mitochondrial membrane proteins

  • Construct Design:

    • Include a cleavable N-terminal tag (His6, GST) for purification

    • Consider removing predicted transmembrane domains for improved solubility

    • Design constructs with and without predicted signal sequences

  • Purification Protocol:

    • Detergent screening (DDM, LMNG, GDN) for optimal extraction

    • Two-step purification: affinity chromatography followed by size exclusion

    • Buffer optimization to maintain enzymatic activity

  • Activity Verification:

    • In vitro processing assays using fluorescently labeled peptide substrates

    • Comparison of wild-type versus catalytically inactive mutant versions

When working with recombinant Immp2l, researchers should account for the fact that it normally functions as part of a complex, and reconstitution of the complete complex may be necessary for full activity assessment.

What are the critical controls needed when assessing phenotypes in Immp2l-deficient models?

Robust experimental design for Immp2l studies should include these critical controls:

  • Genetic Controls:

    • Littermate wild-type controls to minimize background genetic variation

    • Heterozygous animals to assess potential gene dosage effects

    • Rescue experiments with wild-type Immp2l to confirm specificity

  • Molecular Verification:

    • Confirmation of Immp2l protein levels by western blot

    • Assessment of substrate processing efficiency

    • Measurement of mitochondrial ROS production

  • Age and Sex Considerations:

    • Age-matched controls given the age-dependent phenotypes

    • Sex-stratified analyses due to observed sex differences in phenotype severity

    • Hormonal status assessment in female animals

  • Environmental Controls:

    • Standardized housing conditions to minimize stress-induced variability

    • Controlled dietary composition given the metabolic implications

    • Consistent behavioral testing conditions, particularly for stimulus-sensitivity tests

  • Methodological Controls:

    • Inclusion of positive controls (known ROS inducers) in oxidative stress assays

    • Technical replicates to ensure measurement reliability

    • Blinded analysis where applicable to prevent observer bias

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.