Recombinant Mouse Mitochondrial thiamine pyrophosphate carrier (Slc25a19)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
Slc25a19; Mitochondrial thiamine pyrophosphate carrier; Solute carrier family 25 member 19
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-318
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Slc25a19
Target Protein Sequence
MVGYDAKADVRSNSKLEVAVAGSVSGFVTRALISPLDVIKIRFQLQIERLCPSDPNAKYH GIFQAAKQILQEEGPRAFWKGHVPAQILSIGYGAVQFLAFEELTELLYQANLYQTHQFSA HFVCGGLSAGTATLTVHPVDVLRTRLAAQGEPKIYNNLREAIRTMYKTEGPFVFYKGLTP TVIAIFPYAGLQFSCYRSLKRAYDWLIPPDGKQTGNLKNLLCGCGSGVISKTFTYPLDLI KKRLQVGGFEHARSAFGQVRSYRGLLDLTQQVLQEEGTRGFFKGLSPSLMKAALSTGFMF FWYELFCNLFHCIRREDR
Uniprot No.

Target Background

Function
Mitochondrial transporter mediating uptake of thiamine pyrophosphate (ThPP) into mitochondria.
Gene References Into Functions
  1. Chronic alcohol exposure negatively impacts pancreatic mitochondrial thiamin pyrophosphate transport. This effect is at least partially exerted at the level of Slc25a19 transcription and appears to involve an epigenetic mechanism. PMID: 26316591
  2. Mitochondria of Slc25a19(-/-) and Amish lethal microcephaly cells have undetectable and markedly reduced thiamine pyrophosphate content, respectively. PMID: 17035501
  3. We review the evidence suggesting that the function of the SLC25A19 gene product, previously identified as the mitochondrial deoxyribonucleotide carrier (DNC), is actually the transport of thiamine pyrophosphate. [review] PMID: 18280798
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the primary function of SLC25A19 and how was it identified?

SLC25A19, initially misidentified as a mitochondrial deoxyribonucleotide carrier (DNC), is now recognized as the mitochondrial thiamine pyrophosphate (ThPP) transporter. This functional identification was achieved through multiple complementary approaches:

  • Homology searching: Researchers identified ThPP transport as a candidate function of SLC25A19 through sequence homology with known transporters

  • Reconstitution experiments: The function was confirmed using transport assays with recombinant reconstituted protein in liposomes

  • Knockout studies: Slc25a19-/- mitochondria showed undetectable ThPP content, confirming its role

The primary role of SLC25A19 is to transport the essential cofactor ThPP across the inner mitochondrial membrane, where it serves as a cofactor for critical enzymes in energy metabolism including the α-ketoglutarate dehydrogenase complex .

How does Slc25a19 knockout affect mouse development and what phenotypes are observed?

Slc25a19 knockout in mice causes 100% prenatal lethality by embryonic day 12, with several distinctive phenotypes:

Developmental StageObserved Phenotypes in Slc25a19-/- Embryos
E10.5- Neural tube closure defect with ruffling of neural fold ridges
- Yolk sac erythropoietic failure
- Elevated α-ketoglutarate levels in amniotic fluid
By E12- 100% embryonic lethality

The knockout phenotype demonstrates that:

  • Mitochondrial ThPP is essential for normal development

  • Slc25a19-/- mitochondria have undetectable ThPP content

  • The reduction of ThPP causes dysfunction of the α-ketoglutarate dehydrogenase complex

  • This explains the elevated levels of α-ketoglutarate and suggests mitochondrial ThPP transport is critical for CNS development

What human disorders are associated with SLC25A19 mutations?

Mutations in SLC25A19 are associated with two distinct clinical entities:

DisorderPrimary MutationKey Clinical FeaturesThPP LevelsReference
Amish lethal microcephaly (MCPHA)G177ASevere congenital microcephaly (>6 SD below mean), elevated α-ketoglutaric acid (10-100x normal), death by 6 monthsMarkedly reduced
Thiamine metabolism dysfunction syndrome 4 (THMD4)G125S, S194P, Q192HEpisodic encephalopathy, bilateral striatal necrosis, progressive polyneuropathy, episodic weakness, flaccid paralysisSignificantly decreased

Both disorders result from decreased mitochondrial ThPP levels, which impairs the function of ThPP-dependent enzymes, particularly the α-ketoglutarate dehydrogenase complex. This explains the elevated α-ketoglutaric acid observed in MCPHA patients .

What are the kinetic parameters of ThPP transport by recombinant Slc25a19 and how are they measured?

Reconstituted recombinant Slc25a19 exhibits specific transport kinetics for ThPP:

ParameterValueExperimental ConditionReference
Km6.79 ± 0.53 μMMouse liver mitochondria, pH-independent conditions
Transport SpecificityHighest for ThPP; lower for pyrophosphate, ADP, ATPTransport assays with reconstituted protein
pH dependencepH-independentMeasured across physiological pH range

Methodological approach for measuring transport kinetics:

  • Bacterial overexpression of recombinant Slc25a19

  • Protein purification using affinity chromatography

  • Reconstitution into liposomes

  • Transport assays using radioactively labeled substrates (custom-made 3H-TPP)

  • Time-course measurements of substrate uptake

  • Saturation kinetics determination through varying substrate concentrations

The transport process has been characterized as a carrier-mediated, saturable process specific for ThPP, with mitochondrial uptake occurring via exchange with intramitochondrial ATP and/or ADP in some species .

How do specific mutations in Slc25a19 affect protein function, and what methodologies are used to evaluate these effects?

Functional analysis of Slc25a19 mutations utilizes several complementary approaches:

MutationEffect on FunctionMethodological ApproachReference
G177A (MCPHA)Reduced ThPP transport, normal targetingSite-directed mutagenesis, cellular expression, mitochondrial fractionation, transport assays
G125S (THMD4)Impaired ThPP transport, normal targetingSite-directed mutagenesis, GFP-fusion constructs, confocal microscopy, uptake assays
Q192H (THMD4)Reduced protein expression, altered tertiary structure3D homology modeling (Phyre2), site-directed mutagenesis, western blotting

Key methodological approaches for mutation analysis:

  • Site-directed mutagenesis: Using QuickChange™ site-directed mutagenesis kit to introduce specific mutations into expression constructs

  • Protein localization: GFP-fusion constructs and confocal microscopy to assess mitochondrial targeting

  • 3D structure prediction: Homology modeling using Phyre2 server to predict structural changes

  • Functional assays: 3H-TPP uptake measurements in isolated mitochondria or reconstituted systems

  • Expression analysis: Western blotting to assess protein stability and expression levels

Research findings indicate that clinical mutations typically impair ThPP transport function through reduced protein expression or altered substrate binding, rather than through impaired mitochondrial targeting .

What structural features of Slc25a19 are critical for ThPP transport function?

Structure-function analysis of Slc25a19 has identified several key features critical for its transport function:

Structural FeatureFunctional SignificanceExperimental ApproachReference
Three modules (~100 amino acids each)All three cooperate for mitochondrial targetingSerial truncation analysis, GFP-fusion constructs
Six transmembrane domains (TMDs)Form transport channelHomology modeling, protein-docking modeling
Specific residues: Ile33, Ser34, Asp37Critical for substrate recognition/transportProtein-docking model ("Phyre2" and "DockingServer"), site-directed mutagenesis
Positively charged residues: His137, Lys291Important for protein delivery to mitochondriaMultiple sequence alignment ("PRALINE"), mutagenesis
Position 192 (Q192 in humans)Conserved across species, mutation affects tertiary structure3D homology modeling, sequence conservation analysis

A detailed structure-function analysis revealed that:

  • A polar residue at position 34 is essential for transport function

  • Mutations at Ile33 and Asp37 decrease translational efficiency and mitochondrial expression

  • Substrate recognition involves specific residues predicted by docking models

The tertiary structure of Slc25a19 is critical for its function, as demonstrated by the substantial conformational changes caused by the Q192H mutation observed in THMD4 patients .

Expressing and purifying functional Slc25a19 presents several challenges:

ChallengeImpactSolutionsReference
Membrane protein solubilityDifficult to maintain native conformation in solutionReconstitution into liposomes or nanodiscs
Proper foldingMisfolded protein lacks transport activityExpression optimization in bacterial systems
Post-translational modificationsMay affect function or stabilityMammalian expression systems for functional studies
Mitochondrial targetingCytoplasmic accumulation of overexpressed proteinUse of targeting sequences, verification by fractionation
Functional assay sensitivityDetecting low transport activityCustom synthesis of radiolabeled substrates (3H-TPP)

Researchers have addressed these challenges through:

  • Careful optimization of expression conditions

  • Protein purification under conditions that maintain native conformation

  • Reconstitution into artificial membrane systems (liposomes)

  • Development of sensitive functional assays using radiolabeled substrates

  • Complementation of yeast mutants to verify functional activity

These approaches have enabled detailed characterization of Slc25a19's biochemical properties despite the inherent difficulties of working with membrane transport proteins.

How does ThPP depletion in Slc25a19-deficient mitochondria affect cellular metabolism?

ThPP depletion in Slc25a19-deficient mitochondria leads to metabolic dysregulation with multiple downstream effects:

Metabolic EffectMechanismMeasurement ApproachImplicationsReference
α-Ketoglutarate accumulationDysfunction of α-ketoglutarate dehydrogenase complexMeasurement in amniotic fluid and urineBiomarker for diagnosis
Disrupted citric acid cycleReduced activity of ThPP-dependent enzymesEnzymatic activity assaysEnergy metabolism impairment
Impaired neural developmentThPP is critical for CNS developmentAnalysis of knockout embryosExplains microcephaly in patients
Erythropoietic failureDisrupted energy metabolism in developing erythrocytesAnalysis of yolk sac in knockout embryosContributes to embryonic lethality

The dysfunction of the α-ketoglutarate dehydrogenase complex, which requires ThPP as a cofactor, explains the elevated levels of α-ketoglutaric acid observed in MCPHA patients (10-100 times normal levels) . This metabolic signature serves as a diagnostic biomarker and links the molecular defect to the observed phenotype.

These findings highlight the critical importance of mitochondrial ThPP transport for cellular energy metabolism and development, particularly in the central nervous system and during embryogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.