Recombinant Mouse Mitochondrial uncoupling protein 3 (Ucp3)

Shipped with Ice Packs
In Stock

Description

Substrate Transport and Kinetic Properties

UCP3 facilitates the exchange of metabolites and ions across the mitochondrial membrane. Proteoliposome reconstitution assays reveal its substrate specificity :

SubstrateTransport Rate (µmol/min/mg)Inhibition by GTP/GDP
Aspartate23.9 ± 5.876% (GTP), 47% (GDP)
Sulfate17.5 ± 5.192% (phenylsuccinate)
Malate9.57 ± 4.3971% (GTP)
Succinate5.0 ± 3.4Not tested

Data derived from proteoliposome assays using recombinant mUCP3 .

UCP3 also transports protons in a fatty acid (FA)-dependent manner, though this activity is 200–700× weaker than UCP1 .

Metabolic Regulation

  • Glucose Uptake: UCP3 overexpression in skeletal muscle cells increases glucose transport by 2-fold via PI3K-dependent GLUT4 translocation .

  • Fatty Acid Oxidation (FAO): UCP3 expression correlates with FAO markers (e.g., CPT1, PPARα) in cardiomyocytes. It facilitates fatty acid export from mitochondria during lipid overload .

  • ROS Mitigation: UCP3-deficient mice exhibit elevated mitochondrial ROS production, suggesting a role in redox balance .

Tissue-Specific Expression

TissueUCP3 Content (ng/µg protein)
Brown Adipose Tissue0.51 ± 0.11
Heart0.093 ± 0.02
Skeletal Muscle0.058 ± 0.024

Quantified via recombinant mUCP3 calibration in mitochondrial isolates .

Knockout Models and Phenotypes

UCP3-knockout (KO) mice show:

  • Increased Mitochondrial Coupling: State 4 respiration decreases by 30%, elevating ATP synthesis efficiency .

  • Exercise Intolerance: Impaired FA metabolism reduces endurance during prolonged activity .

  • No Thermogenic Defect: Unlike UCP1-KO mice, UCP3-KO mice maintain normal cold-induced thermogenesis .

Functional Mechanisms

  • Activation: Palmitate and superoxide stimulate proton transport, though this is debated .

  • Inhibition: GTP and GDP reduce transport activity by 47–76% .

  • Metabolite Shuttling: UCP3 exports sulfate and aspartate, potentially mitigating ROS damage from hydrogen sulfide metabolism .

Comparative Analysis with UCP2

FeatureUCP3UCP2
Primary SubstratesAspartate, sulfateMalate, oxaloacetate
Tissue ExpressionBAT > heart > muscleImmune cells, pancreatic islets
ROS RegulationIndirect (via metabolite export)Direct (proton leak)

Substrate preferences reflect tissue-specific metabolic demands .

Research Challenges

  • Low Abundance: UCP3 constitutes <0.1% of mitochondrial protein in muscle, complicating detection .

  • Antibody Specificity: Commercial antibodies often cross-react with UCP2 due to high homology .

  • Compensatory Mechanisms: UCP1 and UCP2 are not upregulated in UCP3-KO mice, suggesting independent roles .

Key Research Findings

  1. UCP3 enhances glucose uptake in muscle cells via PI3K signaling, independent of insulin .

  2. Its expression peaks during cardiomyocyte maturation, coinciding with lipid droplet-mitochondria interactions .

  3. Recombinant UCP3 restores FAO capacity in lipid-stressed mitochondria, preventing lipotoxicity .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Ucp3; Slc25a9; Mitochondrial uncoupling protein 3; UCP 3; Solute carrier family 25 member 9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-308
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Ucp3
Target Protein Sequence
MVGLQPSEVPPTTVVKFLGAGTAACFADLLTFPLDTAKVRLQIQGENPGAQSVQYRGVLG TILTMVRTEGPRSPYSGLVAGLHRQMSFASIRIGLYDSVKQFYTPKGADHSSVAIRILAG CTTGAMAVTCAQPTDVVKVRFQAMIRLGTGGERKYRGTMDAYRTIAREEGVRGLWKGTWP NITRNAIVNCAEMVTYDIIKEKLLESHLFTDNFPCHFVSAFGAGFCATVVASPVDVVKTR YMNAPLGRYRSPLHCMLKMVAQEGPTAFYKGFVPSFLRLGAWNVMMFVTYEQLKRALMKV QVLRESPF
Uniprot No.

Target Background

Function
Uncoupling proteins (UCPs) are mitochondrial transporter proteins that facilitate proton leakage across the inner mitochondrial membrane, uncoupling oxidative phosphorylation. This process dissipates energy as heat. UCPs may modulate tissue respiratory control and are involved in thermogenesis and energy balance.
Gene References Into Functions
  1. Early insulin initiation's beneficial effect on lipotoxicity is mechanistically linked to restored UCP3 activity, alleviating energy excess and enhancing AMPK-mediated lipid homeostasis in skeletal muscle cells exposed to palmitic acid and in the gastrocnemius of high-fat diet-fed mice. PMID: 29039450
  2. Heat-induced UCP3 reduction improves mitochondrial efficiency in vitro; however, this does not translate to improved in vivo exercise economy at 1600 m or 4350 m. PMID: 28174343
  3. Adenine nucleotides fully inhibit UCP3, with IC50 increasing as PN-phosphorylation decreases. Conserved arginines in the PN-binding pocket differentially affect UCP1 and UCP3 inhibition. Fatty acids compete only with ATP bound to UCP3. UCP3's function in brown adipose tissue differs from its highly homologous UCP1, suggesting a distinct role and potentially a different transport function. PMID: 29212043
  4. Genetic risk factors for healthy aging differ between sexes, highlighting sex-specific phenotypes and implications for mitochondrial function during aging. PMID: 26965008
  5. UCP3 activity impacts metabolism beyond fatty acid oxidation, regulating pathways associated with amino acid metabolism and redox status. PMID: 27871066
  6. Hypoxia induces temporal changes in genes regulating mitochondrial function and a time-dependent increase in UCP3 expression, accompanied by changes in sarcoplasmic reticulum calcium release protein genes. PMID: 26549555
  7. UCP3 plays an essential role in modulating cardiac mitochondrial Ca2+ uptake by regulating mCa1 single-channel activity. PMID: 27371160
  8. Ectopic expression of constitutively active estrogen receptor alpha decreases UCP3 levels and increases cellular ATP in differentiated C2C12 cells, suggesting estrogen's critical role in regulating energy expenditure and exercise endurance in females. PMID: 27983991
  9. Lactate administration upregulates PDK4 and UCP3, known to be upregulated after exercise and regulated by PGC-1alpha. PMID: 27218871
  10. Vitamin D3/VDR inhibits weight gain by activating UCP3 in muscles. PMID: 27473111
  11. The study investigated the protective effect of PPARalpha activation against cardiac ischemia-reperfusion injury concerning uncoupling protein (UCP) expression. PMID: 26770648
  12. Low 4-Hydroxy-2-nonenal (HNE) doses activate Nrf2 in cardiomyocytes, and Nrf2 binds to the Ucp3 promoter, increasing protein expression. PMID: 25843654
  13. UCP3's loop 2 hydrophilic sequences and matrix-localized hydrophilic domain are necessary for C-terminal Hax-1 binding near the mitochondrial inner membrane. PMID: 26915802
  14. UCP3 overexpression limits keratinocyte proliferation and tumorigenesis via Akt inhibition. PMID: 26310111
  15. Ischemia/reperfusion increases UCP3 transcription, suggesting potential for increased uncoupling. PMID: 25450611
  16. Nrf2 promotes survival by enhancing UCP3 expression under oxidative stress. PMID: 23597505
  17. Trim30 and Ucp3 play pivotal roles in energy balance and glucose homeostasis and may serve as genetic markers for obesity stages during early and late adipose tissue development. PMID: 25895476
  18. In a permanent coronary occlusion mouse model, UCP3 deficiency causes a metabolic shift favoring glycolytic metabolism and increased FDG uptake in remote areas. PMID: 25103673
  19. Circulating acylcarnitines may serve as markers of incomplete muscle fatty acid oxidation, and UCP3 is a potential therapeutic target for metabolic diseases affecting muscle fatty acid oxidation. PMID: 23825224
  20. Ucp3 levels regulate reactive oxygen species levels and cell survival during hypoxia, modulating infarct size in the ischemic heart. PMID: 23688674
  21. UCP3 is critical for cardioprotection against ischemia-reperfusion injury. PMID: 23457013
  22. Grx2 deactivates UCP3 through glutathionylation. PMID: 23335511
  23. While UCP3 may mediate mitochondrial uncoupling and reduced caloric efficiency after high-fat feeding, it does not mediate uncoupling in leptin-deficient states. PMID: 22912419
  24. STC1 activates a novel antioxidant pathway in cardiac myocytes by inducing UCP3. PMID: 22693564
  25. UCP3 may protect mitochondria from lipid-induced dysfunction, but only after prolonged high-fat exposure. PMID: 22115550
  26. UCP3 deficiency does not affect basal or stimulated oxygen consumption in thymocytes or splenocytes or oxygen consumption due to mitochondrial proton leak. PMID: 21689632
  27. No protective effect of UCP3 was observed on oxidative stress markers (4-hydroxynonenal protein adducts and protein carbonyls) in mitochondria. PMID: 21565164
  28. UCP3 deficiency results in a metabolic shift favoring anaerobic glycolysis, increased glucose uptake, and increased sensitivity to oxidative challenge. PMID: 21554247
  29. Native UCP3 lowers ROS production in isolated energized skeletal muscle mitochondria, potentially through a membrane potential-independent mechanism. PMID: 20493945
  30. No evidence suggests UCP3 involvement in basal, fatty acid- or superoxide-stimulated oxygen consumption or GDP sensitivity. PMID: 20227385
  31. UCP3 minimizes adenine nucleotide translocase-mediated energy waste during calorie restriction. PMID: 20206124
  32. UCP3 mediates lipid hydroperoxide (LOOH) translocation across the mitochondrial inner membrane and LOOH-dependent mitochondrial uncoupling. PMID: 20363757
  33. UCP3 is degraded in skeletal muscle and brown adipose tissue mitochondria with a 0.5-4 h half-life, via a proteasome-dependent mechanism. PMID: 19954423
  34. Mice overexpressing UCP3 exhibit excess recovery heat production in isolated muscles. PMID: 12096064
  35. UCP3-underexpressing mice show higher mitochondrial oxidative damage than wild-type controls, suggesting UCP3's role in cellular antioxidant defenses. PMID: 12193161
  36. UCP3 mRNA expression depends on human muscle differentiation. PMID: 12351640
  37. UCP-3 deficient mice show diminished thermogenic response to MDMA ('ecstasy'), offering protection against its toxicity. PMID: 14647371
  38. Transgenic mice show an 18-fold increase in UCP3 mRNA, suggesting therapeutic potential for obesity treatment. PMID: 14673524
  39. C75 treatment caused greater weight loss than pair-feeding and increased skeletal muscle UCP-3 mRNA expression, consistent with increased energy expenditure. PMID: 15063757
  40. Thyroid hormone activates UCP3 gene transcription in vivo via a TRE (thyroid hormone response element) in the proximal promoter region. PMID: 15496137
  41. Findings support UCP3's role in facilitating muscle fatty acid oxidation. PMID: 15814607
  42. UCP3 modulates reactive oxygen species production in response to oxidative stress. PMID: 15922330
  43. UCP3 attenuates endogenous radical production by the mitochondrial electron transport chain at high protonmotive force. PMID: 16084485
  44. UCP3 overexpression in mouse myotubes activates proteolytic systems involved in muscle myofibrillar protein breakdown, suggesting a role in cancer-related muscle wasting. PMID: 16337086
  45. In high-fat-fed mice, UCP3-/- mice had 50% lower intramuscular triacylglycerol levels; however, succinate dehydrogenase activity and FAT/CD36 protein content were similar between genotypes. PMID: 16455084
  46. PPARalpha-dependent regulation is essential for proper UCP3 gene regulation. PMID: 16857752
  47. Apelin treatment increased UCP3 mRNA expression in skeletal muscle. PMID: 17347313
  48. Increasing mitochondrial uncoupling in skeletal muscle may be a therapeutic target for type 2 diabetes mellitus. PMID: 17571165
  49. UCP3 induction suppresses mitochondrial oxidant emission during fatty acid-supported respiration. PMID: 17761668
  50. SIRT1 represses ucp3 gene expression in response to glucocorticoids. PMID: 17884810
Database Links

KEGG: mmu:22229

STRING: 10090.ENSMUSP00000032958

UniGene: Mm.6254

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the fundamental function of UCP3 in mitochondrial metabolism?

UCP3 primarily functions as a metabolite transporter in the mitochondrial inner membrane. Recent biochemical evidence demonstrates that human UCP3 catalyzes the exchange of several metabolic intermediates, including aspartate, malate, oxaloacetate, and phosphate . Unlike the previously dominant hypothesis suggesting UCP3 primarily acts as a proton transporter that decreases respiratory efficiency, its metabolite transport function aligns better with its induction during conditions such as fasting and exercise .

Studies using UCP3 knockout mice further support its role in mitochondrial coupling, as skeletal muscle mitochondria lacking UCP3 show increased coupling (higher state 3/state 4 respiration ratio) due to decreased state 4 respiration . This establishes that endogenous levels of UCP3 contribute to uncoupling mammalian mitochondria .

How does UCP3 differ from other uncoupling proteins in the mitochondrial carrier family?

UCP3 exhibits several distinct characteristics compared to other uncoupling proteins:

  • Tissue Distribution: Unlike UCP2, which is widely distributed, UCP3 expression is restricted primarily to skeletal muscle and brown adipose tissue .

  • Substrate Specificity: While UCP3 shares some substrate specificity with UCP2, it differs in key aspects:

    • UCP3 does not transport malonate (a three-carbon dicarboxylate transported by UCP2)

    • UCP3 transports aspartate and malate more efficiently than sulfate, phosphate, and oxaloacetate

  • Transport Mechanism: A critical distinction is that UCP3 cannot catalyze unidirectional substrate transport, unlike UCP2 which can . UCP3 strictly requires exchange of metabolites.

  • Kinetic Properties: UCP3 exhibits approximately sevenfold higher transport affinity for aspartate compared to UCP2 .

What physiological conditions regulate UCP3 expression?

UCP3, like UCP1, is highly regulated at the transcriptional level by various factors:

  • Fatty acids: Directly induce UCP3 expression in skeletal muscle

  • Diet: Changes in diet composition affect UCP3 levels

  • Exercise: Both acute and regular exercise increase UCP3 expression

  • Fasting: Paradoxically, UCP3 is markedly induced during starvation , a state where energy conservation would seem beneficial

This expression pattern suggests UCP3 has roles beyond simple energy dissipation, potentially including fatty acid metabolism regulation and protection against oxidative damage.

What are the optimal methods for studying UCP3 transport activity in an experimental setting?

Based on recent research, the reconstituted liposome system provides a powerful approach for studying UCP3 transport activity:

  • Recombinant Protein Expression: Express human or mouse UCP3 in bacterial systems

  • Protein Refolding and Reconstitution: Reconstitute the purified protein into liposomes to create proteoliposomes

  • Transport Assays: Measure substrate uptake using radiolabeled compounds (e.g., [14C] aspartate)

  • Exchange Reactions: For UCP3 specifically, design experiments focusing on exchange reactions rather than unidirectional transport, as UCP3 strictly catalyzes metabolite exchanges

For inhibitor studies, several compounds have proven effective at blocking UCP3 activity:

  • Tannic acid

  • Pyridoxal-5'-phosphate

  • Bathophenanthroline

  • Bromocresol purple

  • Butylmalonate

  • Phenylsuccinate

  • 1,2,3-benzentricarboxylate

How can researchers effectively generate and validate UCP3 knockout models?

Based on established protocols for UCP3 knockout generation:

  • Targeting Strategy:

    • Design a replacement targeting vector that removes a critical segment of the UCP3 gene (e.g., between exons 2 and 3, including the start codon)

    • Replace this segment with a selection marker (e.g., PGK-NEO-poly(A) expression cassette)

  • Validation Methods:

    • Genotyping: Southern blot analysis using specific probes

    • Protein Expression: Western blot analysis of skeletal muscle mitochondria using affinity-purified antibodies against UCP3

    • mRNA Expression: Northern blot or RT-PCR to confirm absence of UCP3 mRNA and assess potential compensatory upregulation of other UCPs

  • Functional Validation:

    • Measure respiratory parameters in isolated mitochondria (state 3/state 4 ratios)

    • Assess ROS production in knockout versus wild-type mitochondria

What techniques are most effective for measuring the consequences of UCP3 activity on mitochondrial function?

Several complementary techniques provide robust assessment of UCP3's impact on mitochondrial function:

  • Respiratory Analysis:

    • Measure oxygen consumption in isolated mitochondria using respirometry

    • Compare state 3 (ADP-stimulated) and state 4 (ADP-limited) respiration

    • Calculate the respiratory control ratio (state 3/state 4)

  • ROS Production Measurement:

    • Fluorescent probes for measuring mitochondrial ROS production

    • Compare ROS levels between UCP3-containing and UCP3-deficient mitochondria

  • Membrane Potential Assessment:

    • Use membrane potential-sensitive dyes to evaluate the degree of mitochondrial coupling

    • Compare UCP3 wild-type, knockout, and overexpression models

  • Metabolite Transport Assays:

    • Measure exchange rates of specific metabolites (aspartate, malate, oxaloacetate, phosphate)

    • Use radiolabeled substrates with reconstituted proteoliposomes

How does the metabolite transport function of UCP3 reconcile with its proposed role in uncoupling and thermogenesis?

The relationship between UCP3's metabolite transport and its uncoupling effects represents a complex and evolving understanding:

The discovery that UCP3 functions as a strict metabolite exchanger rather than allowing unidirectional transport suggests its effects on mitochondrial membrane potential may be more regulated and context-dependent than previously thought .

What are the implications of the different transport modes between UCP3 and UCP2 despite their structural similarity?

The discovery that UCP3 strictly catalyzes exchange reactions while UCP2 can perform unidirectional transport has significant implications:

  • Tissue-Specific Metabolic Requirements: The differences in transport modes likely reflect the distinct metabolic needs of tissues where each protein is predominantly expressed. UCP3's restriction to skeletal muscle and brown adipose tissue suggests its exchange function is tailored to the metabolic demands of these highly oxidative tissues .

  • Metabolic Flexibility: UCP3's strict exchange mechanism may permit finer regulation of mitochondrial metabolism, particularly during transitions between different energy substrates, explaining its induction during fasting and exercise .

  • Evolutionary Divergence: Despite 73% amino acid sequence identity between human UCP2 and UCP3, their different transport modes indicate functional specialization following gene duplication events .

  • Therapeutic Targeting: Understanding these mechanistic differences may allow for more precise pharmacological targeting of either UCP2 or UCP3 for metabolic disorders .

How does the R282Q mutation impact UCP3 function at the molecular level?

The R282Q mutation in UCP3 completely abolishes its transport activity . This mutation affects the sixth α-helix of the protein, suggesting critical insights about structure-function relationships:

  • Structural Implications: Arginine 282 likely plays a crucial role in substrate binding or the conformational changes necessary for transport activity.

  • Charge Neutralization: The mutation replaces a positively charged arginine with the neutral glutamine, potentially disrupting electrostatic interactions with negatively charged substrates like aspartate and malate .

  • Evolutionary Conservation: The critical nature of this residue suggests it may be conserved across species and potentially across other members of the mitochondrial carrier family that transport similar substrates.

  • Human Disease Relevance: While specific disease associations with the R282Q mutation have not been fully characterized, the complete loss of transport activity suggests this mutation could have significant physiological consequences if present in human populations .

What is the relationship between UCP3 and reactive oxygen species (ROS) management?

UCP3 plays a significant role in mitigating ROS production and oxidative damage:

  • Increased ROS in UCP3 Deficiency: UCP3 knockout mice demonstrate increased production of ROS in skeletal muscle mitochondria, directly supporting UCP3's role in limiting oxidative stress .

  • Mechanistic Models:

    • Mild Uncoupling Hypothesis: UCP3 may decrease mitochondrial membrane potential below a critical threshold for ROS formation .

    • Lipid Hydroperoxide Export: UCP3 has been proposed to export lipid hydroperoxides (LOOH) from mitochondria, preventing oxidative damage to mitochondrial DNA and proteins .

  • Feedback Regulation: ROS and their byproducts may activate UCP3, creating a negative feedback loop that limits further ROS production when oxidative stress increases .

This protective function against oxidative damage may explain why UCP3 is upregulated during conditions like fasting and exercise, which can increase oxidative stress despite the seemingly contradictory need for energy conservation .

How does UCP3 contribute to fatty acid metabolism in skeletal muscle?

Several lines of evidence suggest UCP3 plays an important role in fatty acid metabolism:

  • Expression Pattern: UCP3 is upregulated by fatty acids and during fasting, when fatty acid oxidation is enhanced .

  • Altered Fatty Acid Oxidation in UCP3 KO: Mitochondria from UCP3 knockout mice show reduced capability to oxidize fatty acids compared to wild-type counterparts .

  • Proposed Mechanisms:

    • UCP3 may facilitate the export of fatty acid anions that cannot be oxidized, preventing their accumulation within mitochondria

    • The metabolite transport function of UCP3 might influence TCA cycle intermediates that indirectly support fatty acid oxidation

    • UCP3's exchange of aspartate and malate might affect the malate-aspartate shuttle, indirectly influencing fatty acid metabolism

  • Human Genetics Evidence: A mutation of the splice donor junction at exon 6 that results in production of truncated UCP3 (UCP3S) has been associated with altered fatty acid oxidation and increased respiratory quotients in some studies, though findings have been inconsistent .

What physiological phenotypes emerge from UCP3 deficiency versus overexpression?

The comparison of UCP3 knockout and overexpression models reveals important insights about its physiological functions:

UCP3 Knockout Phenotypes:

  • Increased mitochondrial coupling (higher state 3/state 4 ratio)

  • Elevated ROS production in mitochondria

  • No significant effects on body weight regulation, exercise tolerance, or cold-induced thermogenesis

  • Reduced capability to oxidize fatty acids

  • Impaired sympathomimetic-mediated thermogenesis

  • Completely absent lipopolysaccharide-induced thermogenesis

  • No compensatory upregulation of other UCP mRNAs (UCP1, UCP2, BMCP1)

UCP3 Overexpression Effects:
While the search results don't provide extensive data on UCP3 overexpression models, studies have suggested that overexpression can:

  • Increase energy expenditure

  • Enhance protection against oxidative stress

  • Improve metabolic flexibility, particularly in relation to fatty acid metabolism

The relatively mild phenotype of UCP3 knockout mice regarding energy balance and thermoregulation suggests compensatory mechanisms may exist that haven't been fully identified .

What are the most promising approaches for translating UCP3 research into therapeutics for metabolic disorders?

Based on current understanding of UCP3 function, several promising research directions emerge:

The recent discovery of UCP3's strict exchange transport mode provides a more precise framework for developing targeted interventions that modulate specific aspects of its function .

What methodological advances would most benefit UCP3 research?

Several methodological advancements would significantly advance UCP3 research:

  • Tissue-Specific Conditional Knockout Models: Developing mice with inducible, tissue-specific UCP3 deletion would help distinguish direct effects from compensatory adaptations.

  • Improved Structural Analysis: High-resolution structural studies of UCP3, particularly in different conformational states during substrate transport, would clarify its mechanism.

  • In Vivo Metabolite Flux Analysis: Technologies to measure metabolite exchange mediated by UCP3 in living cells and tissues would bridge the gap between biochemical studies and physiological functions.

  • Single-Cell Analysis of UCP3 Function: Methods to assess UCP3 activity at the single-cell level would reveal cell-to-cell variability and population dynamics during different physiological states.

  • Physiological Sensors of UCP3 Activity: Development of genetically encoded sensors that report on UCP3 transport activity in real-time would transform our understanding of its regulation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.