Recombinant Mouse Mitoferrin-2 (Slc25a28)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Slc25a28; Mfrn2; Mitoferrin-2; Mitochondrial RNA-splicing protein 3/4 homolog; MRS3/4; Mitochondrial iron transporter 2; Solute carrier family 25 member 28
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-364
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Slc25a28
Target Protein Sequence
MELEGRSAGGVAGGPAAGPGRSPGESALLDGWLQRGVGRGAGGGEAGAYQPPVRLDPESG PEYEALPAGATVTTHMVAGAVAGILEHCVMYPIDCVKTRMQSLQPDPAARYRNVLEALWR IMRTEGLWRPMRGLNVTATGAGPAHALYFACYEKLKKTLSDVIHPGGNSHIANGAAGCVA TLLHDAAMNPAEVVKQRMQMYNSPYHRVTDCVRAVWQNEGAGAFYRSYTTQLTMNVPFQA IHFMTYEFLQEHFNPQRRYNPSSHVLCGACAGAVAAAATTPLDVCKTLLNTQESLALNSN ITGHITGMASAFRTVYQVGGVTAYFRGVQARVIYQIPSTAIAWSVYEFFKYLITKRQEEW RAGK
Uniprot No.

Target Background

Function
Mitoferrin-2 is a mitochondrial iron transporter mediating iron uptake. It is likely essential for heme synthesis in hemoproteins and iron-sulfur cluster assembly in non-erythroid cells. The imported mitochondrial iron, presumably as Fe(II), is subsequently delivered to ferrochelatase, which catalyzes Fe(II) incorporation into protoporphyrin IX to produce heme.
Gene References Into Functions
  1. Cis-regulatory modules (CRMs) controlling the expression of Mfrn genes have been mapped. PMID: 21248200
  2. Mitoferrin 1 and mitoferrin 2 contribute to mitochondrial iron delivery in various cell types. PMID: 19075006
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein. Note=Isoform 1 and isoform 2 are both localized in the mitochondrion.
Tissue Specificity
Ubiquitously expressed at low level. Expressed at higher level in heart, liver, kidney and testis. Expression does not vary during erythroid maturation.

Q&A

What is Mitoferrin-2 (SLC25A28) and what is its primary function in cellular metabolism?

Mitoferrin-2 (SLC25A28) is an inner mitochondrial membrane protein that functions as an iron transporter. It plays a crucial role in transporting free iron ions from the cytosol to mitochondria to support iron-dependent reactions and oxidative phosphorylation. SLC25A28 also regulates the permeability of mitochondrial membranes and helps maintain iron balance and stability within mitochondria . In non-erythroid cells, Mitoferrin-2 serves as the primary mitochondrial iron transporter, enabling essential processes including heme synthesis in hemoproteins and Fe-S cluster assembly .

What is known about the structural organization of Mitoferrin-2?

Mitoferrin-2 is encoded by the SLC25A28 gene located on human chromosome 22q12.3. The protein contains two transmembrane domains and a mitochondrial targeting sequence that directs it to the inner mitochondrial membrane . This structural arrangement facilitates its function as a transporter, allowing it to move iron across the mitochondrial inner membrane in a controlled manner to maintain appropriate iron levels within this crucial organelle .

How does Mitoferrin-2 expression vary across different tissues?

Mitoferrin-2 is predominantly expressed in non-erythroid tissues, with particularly notable expression in metabolically active tissues. Research has documented significant expression in brown adipose tissue (BAT), which contains abundant mitochondria. Cell sublocalization analysis shows that SLC25A28 has the highest expression in mitochondria and lower expression levels in other organelles or cytosol . The differential expression patterns across tissues correlate with the varying mitochondrial iron requirements of different cell types.

What experimental models are most effective for studying Mitoferrin-2 function?

Several experimental models have proven valuable for investigating Mitoferrin-2 function:

  • Adenoviral overexpression systems: Researchers have successfully used tail vein injection of adenovirus (Ad)-SLC25A28 particles into C57BL/6J mice to study the effects of SLC25A28 overexpression on adipose accumulation and metabolic parameters .

  • Cell lines: Human head and neck squamous carcinoma cell lines (UMSCC1, UMSCC14A, and UMSCC22A) have been used to study the role of Mitoferrin-2 in mitochondrial iron uptake and sensitivity to treatments like photodynamic therapy .

  • Knockdown models: siRNA-mediated knockdown of Mitoferrin-2 has been employed to investigate its functional role in mitochondrial iron uptake and cellular responses to stress conditions .

What techniques are most effective for measuring Mitoferrin-2-mediated iron transport activity?

Researchers can employ several methodologies to assess Mitoferrin-2-mediated iron transport:

  • Mitochondrial Fe2+ uptake assays: These measure the rate of iron accumulation in mitochondria and can be compared between cells with different Mitoferrin-2 expression levels. Studies have shown that high Mitoferrin-2-expressing cells demonstrate higher rates of mitochondrial Fe2+ uptake compared to low Mitoferrin-2-expressing cells .

  • Western blotting: This technique enables quantification of Mitoferrin-2 protein expression levels in different tissues. Studies have shown approximately 1.5-fold elevated protein expression of SLC25A28 in brown adipose tissue after administration with Ad-SLC25A28 .

  • Mitochondrial function assays: Measuring parameters such as mitochondrial membrane potential can provide insights into the functional consequences of altered Mitoferrin-2 activity and subsequent iron handling .

How does SLC25A28 overexpression affect adipose tissue and body weight in mouse models?

SLC25A28 overexpression has been shown to significantly impact adipose tissue and body weight in mouse models. Research using adenovirus-mediated overexpression of SLC25A28 in C57BL/6J mice demonstrated:

  • Increased body weight: Mice with SLC25A28 overexpression exhibited remarkably higher body weight compared to control groups after 16 weeks on a high-fat diet (HFD) .

  • Increased adipose tissue mass: The weights of inguinal white adipose tissue (iWAT), epididymal white adipose tissue (eWAT), and brown adipose tissue (BAT) were all significantly increased in the Ad-SLC25A28 group compared to controls .

  • Larger adipocytes: Histological analysis through H&E staining revealed that adipocytes in all adipose tissue types had larger lipid droplets in SLC25A28-overexpressing mice .

What molecular mechanisms link Mitoferrin-2 to adipogenesis and lipid accumulation?

Several molecular mechanisms connect Mitoferrin-2 to adipogenesis and lipid accumulation:

  • Decreased lipolysis: SLC25A28 overexpression significantly reduced adipose triglyceride lipase (ATGL) protein expression in both white and brown adipose tissues, indicating impaired lipolytic capacity .

  • Inhibition of brown adipose tissue function: SLC25A28 overexpression inhibited BAT formation by downregulating uncoupling protein 1 (UCP-1) and the mitochondrial biosynthesis marker PGC-1α, potentially reducing thermogenic capacity and energy expenditure .

  • Altered adipokine secretion: Serum adiponectin protein expression was upregulated while fibroblast growth factor 21 (FGF21) was downregulated following SLC25A28 overexpression, creating a hormonal environment that promotes adipose tissue expansion .

How does SLC25A28 overexpression affect glucose metabolism and insulin sensitivity?

SLC25A28 overexpression has significant effects on glucose homeostasis and insulin sensitivity:

  • Impaired glucose tolerance: Glucose tolerance tests (GTT) have shown that SLC25A28 overexpression significantly decreases glucose clearance efficiency, with glucose levels remaining elevated at 15, 30, 60, and 120 minutes after glucose challenge compared to control mice .

  • Increased fasting glucose: Mice with SLC25A28 overexpression displayed higher fasting glucose levels compared to control groups .

  • Altered lipid profile: Plasma total cholesterol (TC) was significantly increased while plasma triglycerides (TG) were significantly decreased in SLC25A28-overexpressing mice, suggesting complex effects on lipid metabolism .

How does Mitoferrin-2 expression affect cancer cell sensitivity to photodynamic therapy?

Mitoferrin-2 expression levels have been found to significantly influence cancer cell sensitivity to photodynamic therapy (PDT):

  • Differential sensitivity: Human head and neck squamous carcinoma cell lines express varying levels of Mitoferrin-2, with PDT-sensitive cells (UMSCC22A) expressing higher Mitoferrin-2 mRNA and protein levels compared to PDT-resistant cells (UMSCC1 and UMSCC14A) .

  • Enhanced mitochondrial iron uptake: High Mitoferrin-2-expressing cells demonstrate higher rates of mitochondrial Fe2+ uptake, which correlates with increased sensitivity to PDT-induced cell death .

  • Synergistic effect with lysosomal iron release: Lysosomal iron release (induced by bafilomycin) and Mitoferrin-2-dependent mitochondrial iron uptake act synergistically to enhance PDT-mediated and iron-dependent mitochondrial dysfunction and subsequent cell killing .

What experimental approaches can be used to modulate Mitoferrin-2 activity in cancer research?

Several experimental approaches can be employed to modulate Mitoferrin-2 activity in cancer research:

  • RNA interference: siRNA-mediated knockdown of Mitoferrin-2 has been shown to decrease the rate of mitochondrial Fe2+ uptake and delay PDT plus bafilomycin-induced mitochondrial depolarization and cell killing .

  • Pharmacological modulation: Iron chelators and inhibitors of the mitochondrial Ca2+ (and Fe2+) uniporter, such as Ru360, can protect against PDT plus bafilomycin toxicity by interfering with iron-dependent cell death mechanisms .

  • Lysosomal iron mobilization: Bafilomycin, an inhibitor of the vacuolar proton pump of lysosomes and endosomes, causes lysosomal iron release to the cytosol and enhances PDT-induced cell killing of both resistant and sensitive cells, providing a method to potentiate Mitoferrin-2-dependent effects .

How can researchers distinguish between direct effects of Mitoferrin-2 on iron transport versus secondary metabolic effects?

Distinguishing between direct iron transport effects and secondary metabolic consequences requires multiple experimental approaches:

  • Time-course experiments: Monitoring the temporal sequence of events following Mitoferrin-2 modulation can help distinguish primary from secondary effects. Rapid changes in mitochondrial iron content are likely direct effects, while alterations in gene expression and metabolic processes occurring later are more likely secondary consequences.

  • Rescue experiments: If a phenotype is directly due to altered iron transport, it should be rescuable by modulating iron availability. For example, supplementing with iron chelators or iron donors can help determine whether an observed effect is iron-dependent .

  • Mutational analysis: Creating function-specific mutants of Mitoferrin-2 that affect iron transport but not protein-protein interactions (or vice versa) can help parse out which functions are responsible for specific phenotypes.

What are the key considerations when designing studies to investigate Mitoferrin-2 in metabolic disease models?

When designing studies to investigate Mitoferrin-2 in metabolic disease models, researchers should consider:

  • Tissue specificity: Given that Mitoferrin-2 functions differently across tissues, using tissue-specific overexpression or knockout models can provide more precise insights than whole-body approaches .

  • Diet and environmental factors: Since Mitoferrin-2's effects on metabolism are amplified under high-fat diet conditions, carefully controlling dietary composition and duration is essential .

  • Sex differences: Including both male and female animals and analyzing data by sex can reveal important differences in how Mitoferrin-2 affects metabolism in different hormonal environments.

  • Age considerations: The impact of Mitoferrin-2 on metabolism may vary with age, particularly as mitochondrial function changes throughout the lifespan.

  • Comprehensive phenotyping: Beyond measuring body weight and adipose tissue mass, studies should assess energy expenditure, food intake, physical activity, and detailed metabolic parameters to fully understand Mitoferrin-2's role .

What is the potential of Mitoferrin-2 as a therapeutic target in metabolic disorders?

Mitoferrin-2 shows promise as a therapeutic target in metabolic disorders for several reasons:

  • Obesity modulation: Given that SLC25A28 overexpression promotes diet-induced obesity and accelerates lipid accumulation, targeting Mitoferrin-2 to reduce its activity might help combat obesity .

  • Glucose metabolism: SLC25A28 overexpression impairs glucose tolerance, suggesting that inhibiting its function might improve glucose handling in diabetic conditions .

  • Brown adipose tissue activation: Since SLC25A28 overexpression inhibits BAT formation by downregulating UCP-1 and PGC-1α, reducing its activity might enhance brown fat thermogenesis and energy expenditure .

  • Adipokine regulation: Mitoferrin-2 modulation affects important adipokines like adiponectin and FGF21, offering potential avenues to influence systemic metabolic regulation .

How might Mitoferrin-2 serve as a biomarker in clinical scenarios?

Mitoferrin-2 has potential applications as a biomarker in various clinical contexts:

  • Cancer treatment responsiveness: In head and neck cancers, Mitoferrin-2 expression levels correlate with sensitivity to photodynamic therapy, suggesting its utility as a predictive biomarker for treatment response .

  • Metabolic disease risk: Given its role in adipogenesis and lipid accumulation, Mitoferrin-2 expression levels could potentially indicate predisposition to obesity or metabolic syndrome .

  • Mitochondrial dysfunction: As a key mitochondrial iron transporter, altered Mitoferrin-2 levels might serve as a marker for certain forms of mitochondrial dysfunction in both metabolic and neurodegenerative conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.