Recombinant Mouse Mitofusin-1 (Mfn1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Mfn1; Mitofusin-1; Transmembrane GTPase MFN1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-741
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MAETVSPLKHFVLAKKAITAIFGQLLEFVTEGSHFVEATYRNPELDRIASEDDLVEIQGY RNKLAVIGEVLSRRHMKVAFFGRTSSGKSSVINAMLWDKVLPSGIGHTTNCFLSVEGTDG DKAYLMTEGSDEKKSVKTVNQLAHALHMDKDLKAGCLVHVFWPKAKCALLRDDLVLVDSP GTDVTTELDIWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWD ASASEPEYMEDVRRQHMERCLHFLVEELKVVSPSEARNRIFFVSAKEVLNSRKHKAQGMP EGGGALAEGFQARLQEFQNFEQTFEECISQSAVKTKFEQHTIRAKQILDTVKNILDSVNV AAAEKRVYSMEEREDQIDRLDFIRNQMNLLTLDVKKKIKEVTEEVANKVSCAMTDEICRL SVLVDEFCSEFHPTPSVLKVYKSELNKHIEDGMGRNLADRCTNEVNASILQSQQEIIENL KPLLPAGIQNKLHTLIPCKKFDLSYDLNCHKLCSDFQEDIVFRFSLGWSSLVHRFLGSTN AQRVLLGLSEPIFQVPRSLASTPTAPSNPAAPDNAAQEELMITLITGLASLTSRTSMGII VVGGVIWKTVGWKLISVTLSMYGALYLYERLTWTTRAKERAFKQQFVNYATEKLQMIVSF TSANCSHQVQQEMATTFARLCQQVDVTQKHLEEEIARLSKEIDQLEKIQNNSKLLRNKAV QLESELENFSKQFLHPSSGES
Uniprot No.

Target Background

Function
Mitofusin-1 (MFN1) is a mitochondrial outer membrane GTPase that mediates mitochondrial clustering and fusion. Its GTPase activity is essential for membrane clustering and may involve significant rearrangement of coiled-coil domains. Mitochondrial morphology results from the dynamic equilibrium between fusion and fission events. MFN1 overexpression (in vitro) induces the formation of mitochondrial networks. It exhibits low GTPase activity.
Gene References Into Functions
  1. MFN1-mediated mitochondrial dynamics in POMC neurons function as an intrinsic nutrient-sensing mechanism, linking these neurons to insulin release. PMID: 28591639
  2. MFN1 plays a crucial role in maintaining the STING pathway's competency. PMID: 28729291
  3. Despite apparent mitochondrial dysfunction, hearts deficient in both MFN1 and MFN2 exhibit protection against acute myocardial infarction due to impaired mitochondria/sarcoplasmic reticulum tethering. PMID: 27228353
  4. MFN2 deficiency alters lipid droplet morphology in mouse embryonic fibroblasts, but triacylglycerol biosynthesis is independent of ER-mitochondrial tethering. MFN2 does not influence adipocyte differentiation. PMID: 27404125
  5. MFN1 deficiency causes mitochondrial dysfunction and male infertility. PMID: 26711429
  6. Deleting MFN1 eliminates the cardiac lethality observed in Mff knockout mice. PMID: 26598616
  7. Mitochondrial fusion and fission are regulated by four GTPases: MFN1, MFN2, OPA1, and Drp1. [REVIEW] PMID: 26375863
  8. Metabolically stressed mitochondria undergo fusion to reduce oxidative stress. Under glucose starvation, MFN1 associates with HDAC6. PMID: 25271058
  9. Mitochondrial impairment is an early event in Alzheimer's disease pathogenesis, potentially due to abnormal MFN1 and MFN2 expression caused by excess intracellular Aβ. PMID: 24710686
  10. MFN1 is an ERK target, modulating mitochondrial shape and apoptosis. PMID: 25801171
  11. MARCH5 regulates MFN1 levels through quality control of acetylated MFN1. PMID: 24722297
  12. Mitochondrial shape influences BAX-induced membrane permeabilization and apoptosis via MFN1. PMID: 25482509
  13. MFN1 and MFN2 in AgRP neurons regulate whole-body energy metabolism. PMID: 24074868
  14. MFN1 and MFN2 are essential for mitochondrial remodeling during postnatal cardiac development. PMID: 22904094
  15. Cardiomyocyte MFN1 deletion protects against ROS-induced mitochondrial dysfunction. PMID: 22037195
  16. Purkinje cell degeneration involves caspase activation and decreased mitofusin 1 in the Harlequin cerebellum. PMID: 20974255
  17. Double MFN-null cells lack both outer and inner membrane fusion, while OPA1-null cells exhibit uncoupling of outer and inner membrane fusion. PMID: 19477917
  18. The heptad repeat region (HR2) of MFN1 functions as a mitochondrial tether before fusion. PMID: 15297672
  19. OPA1, MFN1, and MFN2 are involved in mitochondrial fusion, cell growth, mitochondrial membrane potential, and cellular respiration. PMID: 15899901
  20. MFN1-MFN2 heterooligomeric complexes are functionally important, and both mitofusins closely interact to control mitochondrial fusion. PMID: 17296794
  21. IL-6 induces Bcl-2 expression to protect against oxygen toxicity by altering interactions between Bak and MFN1/MFN2; Bcl-2 inhibits the Bak-MFN1 interaction. PMID: 19168699
Database Links
Protein Families
TRAFAC class dynamin-like GTPase superfamily, Dynamin/Fzo/YdjA family, Mitofusin subfamily
Subcellular Location
Mitochondrion outer membrane; Multi-pass membrane protein.
Tissue Specificity
Detected in adult heart. Detected in embryos (at protein level). Widely expressed.

Q&A

What is Mitofusin-1 and what are its primary functions?

Mitofusin-1 is a mitochondrial outer membrane GTPase that mediates mitochondrial clustering and fusion. It maintains mitochondrial morphology through a balance of fusion and fission events. Mfn1 has relatively low GTPase activity and requires this activity for membrane clustering. Overexpression of Mfn1 induces the formation of mitochondrial networks in vitro . Beyond fusion, Mfn1 also plays critical roles in regulating mitochondrial DNA (mtDNA) content, which is essential for proper mitochondrial function in various cell types .

How do Mfn1 and Mfn2 differ functionally?

While Mfn1 and Mfn2 share approximately 80% sequence similarity, they exhibit distinct functional differences:

FeatureMfn1Mfn2
Fusion efficiencyHigherLower
Required for OPA1-driven fusionYesNo
Complementary functionsCannot be fully replaced by Mfn2Cannot rescue all Mfn1-dependent functions
Disease associationsLess directly linked to human diseaseMutations cause CMT2A neuropathy
Cell-specific functionsCritical in oocyte developmentMore prominent role in neurons

Notably, genetic studies have shown that OPA1 (a dynamin-related protein of the inner membrane) requires Mfn1 but not Mfn2 to regulate mitochondrial fusion. While Mfn2 can restore mitochondrial shape in Mfn1-deficient cells, it cannot enable OPA1-driven mitochondrial elongation .

What are the optimal techniques for assessing Mfn1-mediated mitochondrial fusion?

The polyethylene glycol (PEG) fusion assay is the gold standard for quantitatively measuring Mfn1-mediated fusion. This method involves:

  • Separating cells into two populations with different fluorescent markers (e.g., yellow fluorescent protein and red fluorescent protein)

  • Co-culturing these cells and inducing fusion with PEG

  • Quantifying the percentage of fused mitochondria (positive for both markers) over time

For kinetic fusion studies, measurements at 2, 4, and 8 hours post-PEG treatment provide reliable fusion curves. In cells with normal Mfn1 levels, fusion typically reaches ~55% after 8 hours, while Mfn1 overexpression can increase this to ~80% .

Alternative methods include:

  • Real-time confocal imaging to visualize mitochondrial contacts and productive tubulation events

  • Electron microscopy to assess mitochondrial ultrastructure

  • Fluorescence recovery after photobleaching (FRAP) in cells expressing mitochondrial-targeted photoactivatable GFP

What are the best approaches for modulating Mfn1 expression in mouse models?

For Mfn1 manipulation in mouse models, consider these methodological approaches:

  • Global knockout: While informative, global Mfn1 knockout can be embryonically lethal, limiting usefulness

  • Conditional tissue-specific knockout: Using Cre-loxP system targeting specific tissues:

    • For β-cell studies: Ins1-Cre or RIP-Cre drivers have been successfully used

    • For cardiac studies: α-MHC-Cre drivers are effective

  • Inducible systems: Tamoxifen-inducible CreERT2 systems allow temporal control of Mfn1 deletion

  • Gene dosage studies: Creating mice with varying Mfn1/2 allele combinations (e.g., Mfn1+/-; Mfn2+/-) to study functional redundancy

For effective phenotyping, mitochondrial content and structure analyses should be performed using mtDNA quantification, electron microscopy, and mitochondrial respiratory function measurements .

How does Mfn1 regulate mitochondrial DNA content?

Mfn1 regulation of mitochondrial DNA (mtDNA) is a critical function that extends beyond its role in fusion. Research has revealed:

  • Mfn1 and Mfn2 maintain mtDNA content by regulating expression of the mitochondrial transcription factor Tfam

  • In β-cells, combined Mfn1/2 deletion reduces mtDNA content, impairs mitochondrial morphology, and decreases respiratory function

  • Gene dosage studies have demonstrated that Mfn1/2 control of glucose homeostasis depends primarily on maintenance of mtDNA content rather than mitochondrial structure

  • Tfam overexpression can ameliorate the reduction in mtDNA content and glucose-stimulated insulin secretion in Mfn1/2-deficient β-cells

This mechanism represents a key physiological role of Mfn1 that is distinct from its architectural function in mitochondrial fusion .

What signaling pathways regulate Mfn1 expression and activity?

Several signaling pathways modulate Mfn1 expression and activity:

  • β-AR/cAMP/PKA/miR-140-5p pathway:

    • This pathway negatively regulates Mfn1 expression

    • Activation leads to increased miR-140-5p levels, which targets Mfn1

    • Results in reduced mitochondrial respiration

    • Studies in non-responding heart failure patients showed increased miR-140-5p and decreased Mfn1 levels

  • Leflunomide-DHODH pathway:

    • Leflunomide acts as an Mfn1 agonist by inhibiting dihydroorotate dehydrogenase (DHODH)

    • Induces Mfn1/2-dependent mitochondrial fusion

    • Increases Mfn1 expression and activates downstream signaling

    • Can enhance antiviral responses by promoting IFN1 production during viral infection

  • Post-translational modifications:

    • Ubiquitination affects Mfn1 stability and function

    • Phosphorylation at specific sites can alter GTPase activity

    • Potential redox regulation through reactive cysteine residues

How does Mfn1 contribute to cardiac function and heart failure models?

Mfn1 plays a crucial role in cardiac function, particularly evident in heart failure:

  • Clinical significance:

    • Mfn1 is significantly reduced in non-responding heart failure patients with idiopathic dilated cardiomyopathy (IDCM)

    • Lower Mfn1 levels correlate with decreased mitochondrial size in cardiomyocytes

    • Mfn1 can serve as a biomarker for heart failure in non-responders

  • Mechanistic findings in mouse models:

    • Cardiac-specific Mfn1 knockout (c-Mfn1 KO) mice show reduced systolic function

    • When subjected to pressure overload via thoracic aortic constriction (TAC), these mice exhibit increased mitochondrial alterations

    • The β-AR/cAMP/PKA/miR-140-5p pathway negatively regulates Mfn1 in cardiac tissue

  • Therapeutic implications:

    • Targeting mitochondrial dynamics and homeostasis represents a promising next-generation therapy for non-responding heart failure patients

    • Interventions that increase Mfn1 expression or activity could potentially improve cardiac function in heart failure patients who don't respond to conventional treatments

What is the role of Mfn1 in preimplantation embryonic development?

Mfn1 has recently been identified as a critical factor in early embryo development:

  • Expression pattern:

    • Mfn1 is continuously expressed during oocyte maturation and throughout preimplantation embryonic development

  • Functional interactions:

    • Mfn1 interacts with PADI6, a key component of the cytoplasmic lattice in oocytes and early embryos

    • Mfn1 deficiency in mice reduces PADI6 levels and decreases expression of translational machinery components

  • Epigenetic regulation:

    • Mfn1 deficiency suppresses protein synthesis activity and lowers histone H3.3 abundance

    • These disruptions lead to failure of male pronucleus formation, aberrant zygotic genome activation, and impaired embryonic development

  • Translational potential:

    • The Mfn1 activator S89 promotes H3.3 incorporation and rescues early development in maternally aged embryos with low Mfn1 levels

    • A positive correlation between Mfn1 and H3.3 protein levels has been observed in early human embryos

How is Mfn1 involved in antiviral immune responses?

Mfn1 plays an unexpected but important role in antiviral immunity:

  • Interaction with MAVS:

    • Mfn1 is constitutively associated with mitochondrial antiviral signaling protein (MAVS)

    • This association is critical for proper MAVS redistribution during viral infection

  • Response to viral infection:

    • Human cytomegalovirus (HCMV) infection causes mitochondrial fusion and increases Mfn1 expression

    • Mfn1 positively regulates HCMV-induced type I interferon (IFN1) response

    • Knockdown of Mfn1 inhibits HCMV-induced redistribution of MAVS and IFN1 production

  • Pharmacological modulation:

    • The Mfn1 agonist leflunomide induces IFN1 production during HCMV infection

    • Treatment increases expression of Mfn1 and phosphorylated TBK1

    • Enhances mRNA expression of IFN-β, IFIT1, IFIT2, and ISG15 in infected cells

How do Mfn1 and OPA1 cooperate in mitochondrial fusion?

The functional relationship between Mfn1 and OPA1 is specific and essential for proper mitochondrial fusion:

  • OPA1 (a dynamin-related protein of the inner membrane) requires Mfn1 but not Mfn2 to regulate mitochondrial fusion

  • Experimental evidence:

    • OPA1 overexpression fails to tubulate and fuse mitochondria lacking Mfn1

    • Reintroduction of Mfn1 in Mfn1-/- cells restores OPA1-induced mitochondrial elongation

    • Mfn2 cannot complement this specific function of Mfn1

  • Process specificity:

    • Total mitochondrial contacts are similar in wild-type, Mfn1-/-, and Mfn2-/- cells

    • The critical difference lies in "productive" contacts leading to tubule formation

    • OPA1 overexpression in wild-type cells increases productive fusion events 2-3 fold

    • This effect depends specifically on Mfn1 presence

  • Working model of cooperation:

    • Mfn1 likely facilitates outer membrane fusion

    • OPA1 then mediates inner membrane fusion

    • This sequential coordination ensures complete mitochondrial fusion

What techniques are most effective for studying Mfn1 protein-protein interactions?

For investigating Mfn1 protein interactions, researchers should consider these methodological approaches:

  • Co-immunoprecipitation (Co-IP):

    • Effective for detecting constitutive associations like Mfn1-MAVS interaction

    • Can be performed using either endogenous proteins or tagged recombinant versions

    • Requires validation with reciprocal pull-downs (Mfn1→partner and partner→Mfn1)

  • Proximity labeling methods:

    • BioID or APEX2 fused to Mfn1 allows identification of proximal proteins in living cells

    • Provides spatial context for interactions at the mitochondrial outer membrane

    • More sensitive than Co-IP for detecting transient interactions

  • Fluorescence microscopy techniques:

    • Förster resonance energy transfer (FRET) for direct protein-protein interactions

    • Fluorescence lifetime imaging microscopy (FLIM) for quantitative interaction assessment

    • Bimolecular fluorescence complementation (BiFC) to visualize interaction locations

  • Genetic complementation assays:

    • Expressing wild-type or mutant Mfn1 in Mfn1-deficient cells

    • Assessing rescue of mitochondrial phenotypes

    • Example: Testing whether Mfn1 can rescue OPA1-driven mitochondrial elongation

How can contradictory findings about Mfn1 function across different cell types be reconciled?

Researchers often encounter seemingly contradictory results regarding Mfn1 function. These can be reconciled through several methodological approaches:

  • Cell-type specific expression analysis:

    • Quantify baseline Mfn1:Mfn2 ratios across cell types

    • Assess compensatory changes in one mitofusin when the other is altered

    • Example: β-cells show different Mfn1/2 requirements than neurons or cardiomyocytes

  • Conditional and inducible knockout strategies:

    • Compare acute versus chronic loss of Mfn1

    • Differentiate between developmental and maintenance roles

    • Use dose-dependent systems to determine threshold effects

  • Domain-specific mutations:

    • Compare GTPase domain mutants versus coiled-coil domain mutants

    • Separate fusion functions from other roles (e.g., mtDNA maintenance)

    • Test chimeric proteins with domains swapped between Mfn1 and Mfn2

  • Context-dependent activity assessment:

    • Measure Mfn1 function under various metabolic conditions

    • Examine stress-induced changes in Mfn1 requirements

    • Incorporate relevant physiological challenges (e.g., glucose stimulation for β-cells)

What is the therapeutic potential of recombinant Mfn1 in diseases with mitochondrial dysfunction?

Recombinant Mfn1 shows promising therapeutic potential in several disease contexts:

  • Comparative effectiveness:

    • In CMT2A models with Mfn2 mutations, Mfn1 overexpression showed higher efficacy than wild-type Mfn2 in rescuing mitochondrial network abnormalities

    • Mfn1 was particularly effective for mutations outside the GTPase domain, like the K357T mutation in the R3 region of Mfn2

  • Delivery systems for recombinant Mfn1:

    • Viral vectors (AAV) can achieve tissue-specific expression

    • Cell-penetrating peptide conjugation may enable protein delivery

    • Nanoparticle encapsulation could improve stability and targeting

  • Potential therapeutic applications:

    DiseaseRationaleTherapeutic Approach
    Heart failureReduced Mfn1 in non-respondersMfn1 gene therapy or agonists
    CMT2AMfn1 rescues Mfn2 mutant phenotypesMfn1 overexpression
    DiabetesMfn1 maintains β-cell mtDNA contentTargeted Mfn1 activation
    Viral infectionsMfn1 enhances IFN responsesMfn1 agonists like leflunomide
    Fertility issuesMfn1 promotes embryo developmentMfn1 activators (e.g., S89)
  • Challenges to overcome:

    • Potential off-target effects due to ubiquitous expression of mitofusins

    • Maintaining appropriate Mfn1 levels to avoid excessive fusion

    • Cell-type specific optimization of delivery and expression

How can recombinant Mfn1 be optimized for enhanced stability and function in experimental systems?

For optimal use of recombinant Mfn1 in research:

  • Protein engineering strategies:

    • Site-directed mutagenesis to enhance GTPase activity

    • Addition of solubilizing tags that preserve function

    • Creation of constitutively active variants through disruption of auto-inhibitory domains

  • Expression and purification optimization:

    • E. coli-derived recombinant human Mfn1 fragments (e.g., Ala2-Lys77) have been successfully generated

    • Mammalian expression systems may better preserve post-translational modifications

    • Insect cell systems balance yield and proper folding

  • Stability enhancements:

    • Point mutations to increase thermal stability

    • Addition of disulfide bonds to stabilize tertiary structure

    • Removal of protease-sensitive regions without compromising function

  • Functional validation:

    • GTPase activity assays to confirm enzymatic function

    • Liposome-based fusion assays for in vitro activity measurement

    • Cell-based rescue experiments in Mfn1-deficient systems to verify biological activity

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.