Recombinant Mouse Mitofusin-2 (Mfn2)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Mitochondrial Dynamics

Recombinant Mfn2 is used to study its dual roles in mitochondrial quality control:

  • Mitochondrial fusion: Mediates outer membrane fusion via HR2 domain interactions .

  • Mitophagy regulation: Promotes Parkin translocation to depolarized mitochondria, enhancing autophagic clearance of damaged organelles .

  • ER-mitochondria tethering: Facilitates inter-organelle communication at mitochondria-associated membranes (MAMs) .

Key Findings from Functional Studies:

  • Knockdown of Mfn2 in mouse oocytes disrupts mitochondrial morphology, spindle assembly, and chromosome segregation .

  • Overexpression in cardiomyocytes reduces angiotensin II-induced ROS production and apoptosis by enhancing mitophagy .

  • Mfn2 binds proteasomal subunits (e.g., 20S and 19S complexes), linking mitochondrial dynamics to protein degradation pathways .

Research Applications and Tools

Recombinant Mfn2 is pivotal in exploring mitochondrial dysfunction in disease models.

Table 1: Common Research Reagents for Mouse Mfn2

ProductApplicationKey FeaturesSource
Mfn2 Antibody (XX-1)WB, IP, IFDetects endogenous Mfn2 in mouse tissues Santa Cruz Biotechnology
FLAG-tagged Mfn2Proteomics studiesIdentifies interactomes (e.g., p97, proteasomal subunits) Custom constructs

Experimental Models:

  • Cardiomyocyte injury: Recombinant Mfn2 overexpression mitigates angiotensin II-induced mitochondrial fragmentation and oxidative stress .

  • Neurodegeneration: Mfn2 mutations (e.g., Charcot-Marie-Tooth type 2A) impair axonal mitochondrial transport, modeled using recombinant variants .

Disease Relevance and Therapeutic Insights

  • CMT2A neuropathy: Over 50 pathogenic MFN2 mutations disrupt GTPase activity or dimerization, leading to mitochondrial fragmentation .

  • Cardiac hypertrophy: Mfn2 deficiency exacerbates mitochondrial damage under hemodynamic stress, while its upregulation restores mitophagy .

  • Cancer and metabolic disorders: Altered Mfn2 expression correlates with aberrant mitochondrial dynamics in tumors and insulin-resistant tissues .

Challenges and Future Directions

  • Structural limitations: Current recombinant forms lack full-length post-translational modifications, affecting functional studies .

  • Therapeutic targeting: Small-molecule enhancers of Mfn2-mediated fusion or mitophagy are under investigation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks. We will fulfill requests whenever possible.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Mfn2; Kiaa0214; Marf; Mitofusin-2; Hypertension-related protein 1; Mitochondrial assembly regulatory factor; HSG protein; Transmembrane GTPase MFN2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-757
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MSLLFSRCNSIVTVKKDKRHMAEVNASPLKHFVTAKKKINGIFEQLGAYIQESASFLEDT HRNTELDPVTTEEQVLDVKGYLSKVRGISEVLARRHMKVAFFGRTSNGKSTVINAMLWDK VLPSGIGHTTNCFLRVGGTDGHEAFLLTEGSEEKKSVKTVNQLAHALHQDEQLHAGSMVS VMWPNSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKQF FHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHMERCTSFLVDELGVVDRAQAGDR IFFVSAKEVLSARVQKAQGMPEGGGALAEGFQVRMFEFQNFERQFEECISQSAVKTKFEQ HTVRAKQIAEAVRLIMDSLHIAAQEQRVYCLEMREERQDRLRFIDKQLELLAQDYKLRIK QITEEVERQVSTAMAEEIRRLSVLVDEYQMDFHPSPVVLKVYKNELHRHIEEGLGRNLSD RCSTAIASSLQTMQQDMIDGLKPLLPVSMRNQIDMLVPRQCFSLSYDLNCDKLCADFQED IEFHFSLGWTMLVNRFLGPKNSRRALLGYSDQVQRPLPLTPANPSMPPLPQSSLTQEELM VSMVTGLASLTSRTSMGILVVGGVVWKAVGWRLIALSFGLYGLLYVYERLTWTTKAKERA FKRQFVEYASEKLQLIISYTGSNCSHQVQQELSGTFAHLCQQVDITRDNLEQEIAAMNKK VEALDSLQSRAKLLRNKAGWLDSELNMFTHQYLQPSR
Uniprot No.

Target Background

Function
Mitofusin-2 (Mfn2) is a mitochondrial outer membrane GTPase that mediates mitochondrial clustering and fusion. Mitochondrial morphology is dynamically regulated by the balance between fusion and fission events. Mfn2 overexpression promotes the formation of mitochondrial networks. Membrane clustering requires GTPase activity and may involve significant rearrangement of coiled-coil domains. Mfn2 plays a central role in mitochondrial metabolism and may be implicated in obesity and/or apoptosis. It also plays a significant role in regulating vascular smooth muscle cell proliferation and is involved in the clearance of damaged mitochondria through mitophagy. Mfn2 is necessary for Parkin recruitment to dysfunctional mitochondria and is involved in the regulation of the unfolded protein response (UPR) during ER stress, influencing apoptosis and autophagy. It acts as an upstream regulator of EIF2AK3, suppressing its activation under basal conditions.
Gene References Into Functions
  1. Normal Mfn2 gene function is crucial for proper lens development and transparency. PMID: 29367651
  2. miR-497 promotes cardiomyocyte proliferation and inhibits apoptosis by downregulating Mfn2 in a myocardial I/R injury mouse model. PMID: 29852387
  3. Mitofusin 2 ameliorates ischemia-reperfusion injury primarily by promoting autophagy. PMID: 29734176
  4. Mfn2 knockdown attenuates hypoxia-induced apoptosis. PMID: 29097872
  5. In Mfn2-deficient cardiac mitochondria, 3D electron tomography reveals increased volume, elongation, and reduced mitochondria-sarcoplasmic reticulum contacts. PMID: 28904083
  6. These findings provide insights into Mfn2-mediated cellular alterations, potentially impacting oocyte maturation. PMID: 27485634
  7. Mfn2 downregulation affects in vitro oocyte maturation and fertilization by modulating meiosis and mitochondrial function. PMID: 27469431
  8. Brown adipose tissue (BAT) adaptation to obesity is regulated by Mfn2. In the absence of BAT-Mfn2, BAT's contribution to preventing insulin resistance is independent of and inversely correlated with whole-body cold-stimulated thermogenesis. PMID: 28539390
  9. Mfn2 acts as an endoplasmic reticulum-mitochondria tether; its ablation reduces interorganellar proximity and communication. PMID: 27647893
  10. Mitofusin 2 maintains mitochondrial architecture and regulates mitochondrial metabolism, calcium signaling, mitochondrial DNA levels, cell proliferation, and differentiation. [REVIEW] PMID: 28132466
  11. Despite mitochondrial dysfunction, hearts lacking both Mfn1 and Mfn2 are protected against acute myocardial infarction due to impaired mitochondria/sarcoplasmic reticulum tethering. PMID: 27228353
  12. Presenilin 2 (PS2), associated with familial Alzheimer's disease (FAD), promotes endoplasmic reticulum-mitochondria coupling only in the presence of Mfn2. PMID: 27239030
  13. Post-translational modification of Mfn2 is linked to its dysregulation during metabolic vulnerability preceding glaucomatous degeneration. PMID: 28684211
  14. Mfn2 dysregulation plays a critical role in mitochondrial dysfunction during Alzheimer's disease progression; its decreased expression is partly regulated by miR-195. Upregulating Mfn2 by reducing miR-195 may offer a therapeutic strategy for Alzheimer's disease. PMID: 27693395
  15. Mfn2 downregulation or Parkin expression restores cytosolic Ca(2+) transients in fibroblasts from PARK2 mutation patients; a catalytically inactive Parkinson's disease (PD)-related Parkin variant has no effect. Parkin regulates ER-mitochondria contacts, providing insights into Parkin loss of function in PD. PMID: 27206984
  16. Mfn2 mediates mitochondria-lipid droplet interactions, influencing lipolytic processes and whole-body energy homeostasis. PMID: 28348166
  17. PPAR-β regulates neuronal differentiation via Mfn2 and mitochondrial Ca(2+), influencing mitochondrial energy metabolism. PMID: 27315062
  18. Aging-induced Mfn2 decrease underlies age-related alterations in metabolic homeostasis and sarcopenia in muscle Mfn2-deficient mice. PMID: 27334614
  19. Mice hemizygous for a pathogenic Mfn2 allele exhibit hind limb/foot gait deficits and nerve and muscle phenotypic perturbations. PMID: 27907123
  20. Mfn2-deficient mouse embryonic fibroblasts exhibit altered lipid droplet morphology; however, triacylglycerol biosynthesis is independent of ER-mitochondrial tethering mediated by mitofusins. Mfn2 is not involved in adipocyte differentiation. PMID: 27404125
  21. Mitofusin 2 overexpression may attenuate hypoxia-induced apoptosis. PMID: 26434502
  22. Mitofusin 2, in addition to its role in mitochondrial fusion, is crucial for maintaining coenzyme Q levels and may be involved in the mevalonate synthesis pathway. PMID: 27060252
  23. Low Mfn2 expression is implicated in premature ovarian failure, affecting mitochondrial energy metabolism and apoptosis. PMID: 26327438
  24. A balance exists between the negative metabolic consequences of Mfn2 deficiency and adaptive processes (increased PGC-1α and TFAM), preventing mtDNA depletion and severe metabolic impairment. PMID: 26230519
  25. HDAC6 critically regulates MFN2 degradation by MARCH5, protecting mitochondrial connectivity from hypoxic stress. PMID: 26210454
  26. Mfn2 attenuates blastocyst formation and cleavage speed in mouse zygotes, causing mitochondrial dysfunction (as evidenced by ATP, mtDNA levels, and mitochondrial membrane potential). PMID: 25978725
  27. Mfn2 is essential for maintaining hematopoietic stem cells (HSCs) with extensive lymphoid potential, but less so for myeloid-dominant HSCs. PMID: 26789249
  28. Mutations in the mitofusin 2 gene primarily manifest in the peripheral nervous system. PMID: 25574749
  29. Mitochondrial fusion and fission are regulated by four GTPases: Mfn1, Mfn2, OPA1, and Drp1. [REVIEW] PMID: 26375863
  30. Mfn2 silencing significantly reduces mitochondrial Ca(2+) uptake at the triad junction due to mitochondrial membrane potential depolarization. PMID: 25477138
  31. Mfn2 acts as a tethering antagonist, preventing excessive ER-mitochondria proximity. PMID: 25870285
  32. Mfn2 deficiency accelerates renal function recovery and enhances survival after ischemic acute kidney injury. PMID: 25201884
  33. Mitochondrial impairment is an early event in Alzheimer's disease pathogenesis; abnormal Mfn1 and Mfn2 expression caused by intracellular Aβ is a potential mechanism. PMID: 24710686
  34. Mitofusin 2 overexpression significantly inhibits β-amyloid-mediated cell death. PMID: 25359615
  35. Mfn2 is involved in maintaining the terpenoid biosynthesis pathway, necessary for mitochondrial coenzyme Q biosynthesis. PMID: 25688136
  36. Calpain-mediated MFN2 degradation regulates mitochondrial fusion during glutamate excitotoxicity. PMID: 25416777
  37. Cardiac-specific Mfn2 knockout mice exhibit impaired parkin-mediated mitophagy, leading to damaged ROS-producing organelle accumulation and progressive heart failure. PMID: 24874428
  38. MiR-106b targets Mfn2, regulating skeletal muscle mitochondrial function and insulin sensitivity. PMID: 23954742
  39. Mitofusin 2 is required for NLRP3 inflammasome activation after RNA virus infection. PMID: 24127597
  40. Mfn2 in pro-opiomelanocortin neurons regulates systemic energy balance by fine-tuning mitochondrial-endoplasmic reticulum axis homeostasis and function. PMID: 24074867
  41. Mfn1 and Mfn2 in agouti-related peptide (AgRP) neurons regulate whole-body energy metabolism. PMID: 24074868
  42. Mfn2 modulates the unfolded protein response and mitochondrial function via PERK repression. PMID: 23921556
  43. Mfn2 loss leads to progressive, retrograde degeneration of nigrostriatal dopaminergic neurons. PMID: 22859504
  44. Mfn2, but not Mfn1, is necessary for in vivo axonal projections of dopaminergic neurons. PMID: 22914740
  45. Increased endoplasmic reticulum-mitochondria juxtaposition is observed in Mitofusin-2-null embryonic fibroblasts. PMID: 23029466
  46. Mfn2 mutations alter mitochondrial dynamics and induce retinal and cardiac pathology. PMID: 22957060
  47. Mfn2 maintains glucose and lipid homeostasis and is involved in insulin resistance development. PMID: 20037808
  48. Mfn2-mediated SR-mitochondria tethering is crucial for normal interorganelle Ca(2+) signaling in the myocardium. PMID: 22777004
  49. Mfn1 and Mfn2 are essential for mitochondrial remodeling during postnatal cardiac development. PMID: 22904094
  50. Mfn2 deficiency causes multiple molecular and functional defects leading to cardiac vulnerability and dysfunction. PMID: 22619176
Database Links
Protein Families
TRAFAC class dynamin-like GTPase superfamily, Dynamin/Fzo/YdjA family, Mitofusin subfamily
Subcellular Location
Mitochondrion outer membrane; Multi-pass membrane protein.
Tissue Specificity
Ubiquitous. Expression is markedly reduced in ApoE-knockout mouse atherosclerotic arteries.

Q&A

What is Mitofusin-2 (Mfn2) and what are its primary functions in mice?

Mitofusin-2 (Mfn2) is a mitochondrial outer membrane protein that plays a key role in mitochondrial fusion and tethering to other organelles. In mice, as in other mammals, Mfn2 is essential for embryonic development, anti-apoptotic events, and protection against free radical-induced lesions . It has been identified as a powerful suppressor of cell proliferation both in vivo and in vitro, with its anti-proliferative effect mediated through inhibition of ERK/MAPK signaling and subsequent cell-cycle arrest . Additionally, Mfn2 contributes to mitochondrial quality control by facilitating the fusion process that helps maintain metabolic homeostasis, which is particularly important in tissues with high energy demands. The protein is also involved in establishing contacts between mitochondria and lipid droplets, as evidenced by reduced contacts in Mfn2 R707W knock-in animals .

What are the tissue-specific expression patterns of Mfn2 in mice?

Mfn2 is expressed in multiple tissues in mice, with expression levels varying by tissue type. Based on research with Mfn2 R707W knock-in mice, Mfn2 is detectably expressed in inguinal white adipose tissue (WAT), brown adipose tissue (BAT), epididymal WAT, liver, heart, and skeletal muscle . Interestingly, the R707W mutation appears to affect Mfn1 and Mfn2 expression differently across tissues. In BAT of knock-in mice, both Mfn1 and Mfn2 expression levels were lower compared to wild-type after high-fat diet feeding, while only Mfn1 expression was reduced on chow diet . In epididymal WAT, Mfn1 expression was lower in knock-in mice on chow diet, but no differences were observed in mice fed a high-fat diet . This tissue-specific expression pattern and response to genetic modification suggests specialized roles for Mfn2 in different cell types, particularly in adipose tissues where it appears to have non-redundant functions .

How can I generate recombinant mouse Mfn2 mutants for research?

To generate recombinant mouse Mfn2 mutants, CRISPR-Cas9 genomic engineering is an effective approach, as demonstrated in the creation of Mfn2 R707W knock-in mice. The procedure involves designing specific sgRNAs targeting the desired region of the Mfn2 gene along with a single-stranded oligonucleotide donor (ssODN) template containing your mutation of interest .

For the R707W mutation specifically, researchers have used the following protocol:

  • Design complementary sgRNAs targeting exon regions of the Mfn2 gene (e.g., 5'-CACCgTTCCTGCTCCAGATTATCTC-3' and 5'-AAACGAGATAATCTGGAGCAGGAAc-3') .

  • Prepare an ssODN template incorporating your desired mutation (e.g., changing codon 707 from CGA to TGG) and possibly including silent mutations to create restriction sites for genotyping purposes .

  • Inject purified sgRNA (20 ng/μL), Cas9 protein (100 ng/μL), and the ssODN template (10 ng/μL) into one pronucleus of two-pronuclear stage mouse embryos .

  • Reimplant injected embryos into pseudopregnant foster mothers .

  • Confirm successful mutation by Sanger sequencing of founder animals .

  • Establish the line through breeding with wild-type C57BL/6J mice .

This approach allows for precise genetic modification while minimizing off-target effects by using protein-based Cas9 rather than a plasmid-based expression system.

What are the optimal conditions for expressing and purifying recombinant mouse Mfn2 protein?

For expressing and purifying recombinant mouse Mfn2 protein, a systematic approach is necessary due to the protein's membrane-bound nature. The following protocol is recommended:

  • Expression System Selection: Bacterial expression systems like E. coli often struggle with proper folding of mammalian membrane proteins. Consider using:

    • Insect cell expression systems (Sf9 or Hi5 cells) with baculovirus vectors

    • Mammalian expression systems (HEK293 or CHO cells) for proper post-translational modifications

  • Construct Design: Create a construct with:

    • An N-terminal tag (His6 or GST) for purification

    • A protease cleavage site for tag removal

    • Careful consideration of transmembrane domains, possibly using truncated constructs that omit these regions for improved solubility

  • Purification Strategy:

    • Solubilize membranes with detergents like DDM, LMNG, or digitonin

    • Use affinity chromatography (Ni-NTA for His-tagged proteins)

    • Perform size exclusion chromatography to improve purity

    • Consider detergent exchange during purification to find optimal stability conditions

  • Quality Control:

    • Verify protein identity by mass spectrometry

    • Assess protein homogeneity by dynamic light scattering

    • Test functional activity through GTPase assays

The choice of expression system and purification strategy should be optimized based on the intended application, whether structural studies, in vitro functional assays, or antibody production.

What methods are effective for studying Mfn2 function in mouse oocytes?

Studying Mfn2 function in mouse oocytes requires specialized techniques due to the unique characteristics of these cells. Based on published research, effective methods include:

  • Gene knockdown approaches: Microinjection of specific siRNAs targeting Mfn2 into germinal vesicle (GV) stage oocytes has been successfully used to deplete Mfn2 and study its functions . This approach allows for temporal control of protein depletion.

  • Protein localization analysis: Immunofluorescence microscopy using specific anti-Mfn2 antibodies can reveal the subcellular distribution of Mfn2 during different stages of oocyte maturation . Co-staining with markers like α-tubulin can identify potential functional associations.

  • Mitochondrial morphology assessment: Transmission electron microscopy (TEM) provides detailed visualization of mitochondrial ultrastructure and can reveal changes in morphology, cristae structure, and mitochondrial-organelle contacts following Mfn2 manipulation .

  • Functional assays:

    • Spindle structure and chromosome alignment can be assessed following Mfn2 depletion to determine effects on meiotic progression

    • First polar body extrusion rates serve as a measure of successful meiotic maturation

    • Analysis of p38 MAPK distribution can reveal signaling pathway alterations

These methods collectively allow for comprehensive analysis of Mfn2's role in oocyte maturation, linking molecular mechanisms to cellular phenotypes.

How can I design experiments to study the role of Mfn2 in mitochondrial dynamics?

Designing experiments to study Mfn2's role in mitochondrial dynamics requires multifaceted approaches that combine genetic manipulation with advanced imaging techniques:

  • Live-cell imaging of mitochondrial fusion events:

    • Express fluorescent protein-tagged mitochondrial markers (e.g., matrix-targeted GFP) in cells with wild-type or mutant Mfn2

    • Use photoactivatable GFP (PA-GFP) to track specific mitochondrial populations over time

    • Employ high-resolution time-lapse confocal microscopy to quantify fusion rates

    • Calculate fusion efficiency by measuring the diffusion rate of photoactivated markers

  • Electron microscopy for ultrastructural analysis:

    • Use transmission electron microscopy (TEM) to assess mitochondrial morphology, size, and cristae structure in tissues from wild-type versus Mfn2 mutant mice

    • Quantify parameters such as mitochondrial perimeter, cross-sectional aspect ratio, and cristae density

    • Examine mitochondrial-organelle contacts, particularly with lipid droplets

  • Functional consequence assessment:

    • Measure oxygen consumption rates using Seahorse XF analyzers

    • Assess membrane potential using potentiometric dyes (TMRM, JC-1)

    • Analyze ATP production and mitochondrial calcium handling

  • Inducible systems for temporal control:

    • Use Cre-loxP systems with tamoxifen-inducible promoters to control the timing of Mfn2 deletion or mutation expression

    • Apply CRISPR interference (CRISPRi) for reversible knockdown of Mfn2

These approaches would allow researchers to distinguish the direct effects of Mfn2 on mitochondrial fusion from secondary consequences on other cellular processes.

What are the key considerations when studying the R707W mutation in mouse Mfn2?

When studying the R707W mutation in mouse Mfn2, researchers should consider several critical factors to ensure robust and translatable results:

  • Genetic background effects: The phenotypic manifestation of the R707W mutation may vary depending on the genetic background of the mice. C57BL/6J background has been used successfully, but researchers should consider whether their specific question might benefit from a different background or from studying the mutation on multiple backgrounds .

  • Homozygosity versus heterozygosity: While homozygous R707W mice (Mfn2 R707W/R707W) have been generated and studied, human patients typically carry heterozygous mutations. Researchers should carefully consider whether homozygous or heterozygous models better address their research question .

  • Age-dependent phenotypes: The phenotypic manifestations of the R707W mutation may develop over time. Studies should include multiple time points to capture age-dependent changes, as seen in the different results between mice on 4-week versus 6-month feeding protocols .

  • Diet interactions: The R707W mutation shows different effects depending on whether mice are fed standard chow or high-fat diets. This diet-genotype interaction is important to consider in experimental design, as it may reveal conditional phenotypes .

  • Tissue-specific effects: The R707W mutation appears to affect tissues differently, with notable effects in adipose tissues but not in liver, heart, or skeletal muscle. Comprehensive tissue sampling is therefore important .

  • Interspecies differences: While the R707W mutation causes severe lipodystrophy and metabolic disease in humans, mice with the same mutation show milder phenotypes, primarily affecting adipokine secretion without dramatic changes in fat distribution or glucose metabolism . These differences should be acknowledged when extrapolating findings to human disease.

How can I investigate the interaction between Mfn2 and cellular stress responses?

To investigate the interaction between Mfn2 and cellular stress responses, particularly the integrated stress response (ISR), consider the following experimental approaches:

  • Transcriptomic analysis:

    • Perform RNA sequencing on tissues from wild-type versus Mfn2 mutant mice to identify differentially expressed genes related to stress pathways

    • Focus analysis on ISR-related genes, particularly those regulated by ATF4

    • Validate key findings with RT-qPCR of selected stress-response genes

  • Protein-level assessment of stress pathway activation:

    • Western blotting for phosphorylated eIF2α, a key marker of ISR activation

    • Immunoblotting for ATF4, CHOP, and other downstream effectors of the ISR

    • Subcellular fractionation to assess nuclear translocation of stress-response transcription factors

  • Pharmacological manipulation:

    • Use ISR inducers (tunicamycin, thapsigargin) to determine if they phenocopy effects of Mfn2 mutation on adipokine secretion

    • Apply ISRIB (integrated stress response inhibitor) to test whether ISR inhibition rescues phenotypes caused by Mfn2 mutation

    • Compare responses to different stressors (ER stress, amino acid deprivation, oxidative stress) to pinpoint the specific stress pathway affected

  • Secretome analysis:

    • Collect conditioned media from adipose tissue explants of wild-type versus Mfn2 mutant mice

    • Perform multiplex ELISA or mass spectrometry to quantify secreted adipokines and other proteins

    • Correlate changes in secreted proteins with markers of ISR activation

  • In vivo metabolic phenotyping:

    • Measure serum adipokines (leptin, adiponectin) in different nutritional states

    • Assess glucose tolerance and insulin sensitivity

    • Analyze tissue-specific metabolism using metabolomics approaches

This multifaceted approach would provide comprehensive insights into how Mfn2 dysfunction triggers stress responses and how these responses subsequently affect cellular function.

What techniques are most effective for studying Mfn2 in adipose tissue?

Studying Mfn2 in adipose tissue requires specialized techniques that address the unique challenges of this tissue type. Based on published research, the following methods are particularly effective:

  • Tissue-specific Mfn2 expression analysis:

    • Western blotting with adipose depot-specific sampling (inguinal WAT, epididymal WAT, BAT)

    • Immunohistochemistry to visualize Mfn2 distribution within adipose tissue

    • RT-qPCR for quantification of Mfn2 mRNA levels across different adipose depots

  • Mitochondrial morphology assessment:

    • Transmission electron microscopy (TEM) to visualize mitochondrial ultrastructure in adipocytes

    • Quantification of mitochondrial parameters including perimeter, aspect ratio, and cristae structure

    • Analysis of mitochondria-lipid droplet contacts in adipose tissue sections

  • Ex vivo functional studies:

    • Adipose tissue explant culture to assess basal and stimulated adipokine secretion

    • Oxygen consumption measurements in isolated adipose tissue

    • Primary adipocyte isolation and culture for cell-autonomous studies

  • Metabolic phenotyping relevant to adipose function:

    • Quantification of serum leptin and adiponectin levels by ELISA

    • Assessment of adipocyte size and number through histological analysis

    • Lipolysis assays to measure triglyceride metabolism

  • Molecular pathway analysis:

    • RNA sequencing to identify differentially expressed genes in adipose tissue of Mfn2 mutant mice

    • Pathway analysis focusing on mitochondrial function, integrated stress response, and adipokine biosynthesis

    • Protein analysis of stress response markers in adipose tissue lysates

These methodological approaches allow for comprehensive assessment of how Mfn2 mutations or deficiency affect adipose tissue structure and function at multiple levels.

How should I design experiments to assess the impact of Mfn2 on reproduction and oocyte development?

Designing experiments to assess Mfn2's impact on reproduction and oocyte development requires specialized approaches that target different stages of oogenesis and early embryonic development:

  • Oocyte-specific manipulation of Mfn2:

    • Microinjection of Mfn2-targeting siRNAs into germinal vesicle (GV) stage oocytes

    • Generation of oocyte-specific conditional knockout mice using Zp3-Cre or similar systems

    • Rescue experiments with wild-type or mutant Mfn2 mRNA injection

  • Assessment of meiotic progression:

    • Time-lapse imaging of oocyte maturation to track germinal vesicle breakdown (GVBD) and first polar body extrusion

    • Immunofluorescence staining for spindle structure (α-tubulin) and chromosome alignment

    • Quantification of maturation rates at different time points

  • Mitochondrial analysis in oocytes:

    • Live-cell imaging of mitochondrial distribution using specific dyes (MitoTracker)

    • TEM analysis of mitochondrial ultrastructure in oocytes at different maturation stages

    • Measurement of mitochondrial membrane potential and ATP production

  • Signaling pathway investigation:

    • Assessment of p38 MAPK localization following Mfn2 depletion

    • Analysis of other MAPK family members (ERK1/2, JNK) to determine pathway specificity

    • Pharmacological inhibition of specific pathways to determine epistatic relationships

  • Reproductive outcome evaluation:

    • Fertilization rate assessment following in vitro fertilization of Mfn2-manipulated oocytes

    • Early embryonic development monitoring to determine cleavage and blastocyst formation rates

    • Implantation and pregnancy success rates in genetic models

These approaches would provide comprehensive insights into Mfn2's role throughout oocyte maturation and early embryonic development, linking molecular mechanisms to reproductive outcomes.

What are the best practices for analyzing mitochondrial fusion defects in Mfn2 mutant models?

Analyzing mitochondrial fusion defects in Mfn2 mutant models requires a combination of morphological, functional, and molecular approaches:

  • Quantitative morphological analysis:

    • Transmission electron microscopy (TEM) with standardized sampling across tissues

    • Measurement of key parameters including:

      • Mitochondrial perimeter and area

      • Mitochondrial aspect ratio (length/width) as an indicator of fragmentation

      • Cristae number and structure

      • Contacts with other organelles, particularly lipid droplets

    • 3D reconstruction of mitochondrial networks using serial section EM or focused ion beam-scanning electron microscopy (FIB-SEM)

  • Live cell imaging approaches:

    • Fluorescent protein labeling of mitochondria in primary cells isolated from Mfn2 mutant mice

    • Photoactivation assays to directly measure fusion events

    • FRAP (Fluorescence Recovery After Photobleaching) analysis to assess mitochondrial connectivity

  • Functional consequences assessment:

    • Respirometry to measure oxygen consumption rates in isolated mitochondria

    • Membrane potential analysis using potentiometric dyes

    • mtDNA copy number and distribution analysis

    • Assessment of mitochondrial calcium handling

  • Molecular analysis of mitochondrial dynamics machinery:

    • Expression analysis of other fusion/fission proteins (Mfn1, OPA1, Drp1) to identify compensatory changes

    • Interaction studies to determine how mutations affect protein-protein interactions

    • GTPase activity assays to assess functional enzymatic capacity

  • Standardized reporting practices:

    • Blind analysis of images to prevent bias

    • Sufficient biological replicates (minimum n=3 animals per genotype)

    • Consistent imaging parameters across experimental groups

    • Automated analysis workflows to reduce subjective assessment

By combining these approaches, researchers can comprehensively characterize mitochondrial fusion defects at multiple scales, from molecular mechanisms to cellular and tissue-level consequences.

How do I interpret contradictory findings between mouse models and human patients with Mfn2 mutations?

Interpreting contradictory findings between mouse models and human patients with Mfn2 mutations requires careful consideration of several factors:

  • Species-specific differences in Mfn2 function and compensation:

    • Mice may have different compensatory mechanisms through Mfn1 or other fusion proteins

    • Regulatory networks governing Mfn2 expression may differ between species

    • Background genetic modifiers may exist in mice that are absent in humans

  • Phenotypic timeline considerations:

    • Human phenotypes develop over decades, while mouse studies typically span months

    • Age-equivalent comparisons should be considered (e.g., 2-year-old mice vs. middle-aged humans)

    • Progressive phenotypes may require longer observation in mouse models

  • Homozygosity versus heterozygosity effects:

    • Many mouse studies use homozygous mutants, while human patients are typically heterozygous

    • Dose-dependent effects of mutations may explain phenotypic differences

    • Direct comparison of heterozygous mice with human patients may be more informative

  • Environmental factors:

    • Controlled laboratory conditions for mice versus variable human environments

    • Dietary differences between standardized mouse chow and human diets

    • Activity levels and other lifestyle factors that differ between species

  • Analytical approach for reconciling differences:

    • Focus on molecular and cellular phenotypes that are consistent across species

    • Use patient-derived cells or tissues alongside mouse models when possible

    • Consider humanized mouse models expressing human MFN2 variants

For example, in the case of the R707W mutation, mice show mitochondrial fragmentation and reduced adipokine secretion similar to humans, but do not develop the dramatic lipodystrophy phenotype seen in patients . This suggests that while the primary molecular mechanism is conserved, downstream consequences or compensatory responses differ between species.

What are common technical challenges when working with recombinant Mfn2 and how can they be overcome?

Working with recombinant Mfn2 presents several technical challenges due to its nature as a membrane-bound GTPase. Here are common issues and strategies to overcome them:

  • Protein solubility and stability issues:

    • Challenge: Full-length Mfn2 contains transmembrane domains that make it difficult to express and purify in soluble form.

    • Solution: Consider using truncated constructs that omit transmembrane domains but retain functional domains of interest. Alternatively, use specialized detergents like digitonin, LMNG, or GDN for extraction while maintaining protein function.

  • Expression system limitations:

    • Challenge: Bacterial expression systems often fail to properly fold mammalian membrane proteins.

    • Solution: Use eukaryotic expression systems such as insect cells (Sf9, Hi5) or mammalian cells (HEK293, CHO) that provide appropriate folding machinery and post-translational modifications.

  • Functional assay development:

    • Challenge: Assessing GTPase activity of recombinant Mfn2 requires specialized assays that maintain protein in a near-native environment.

    • Solution: Develop liposome-based reconstitution systems or use detergent-solubilized protein with careful validation of activity. Colorimetric GTPase assays or coupled enzyme systems can provide quantitative readouts.

  • Mutation-specific effects:

    • Challenge: Different mutations may affect protein stability, expression, or function in distinct ways.

    • Solution: Perform systematic characterization of each mutation through thermal stability assays, expression level quantification, and functional testing. Use wild-type protein as a consistent control.

  • Antibody specificity concerns:

    • Challenge: Commercial antibodies may cross-react with Mfn1 due to sequence homology.

    • Solution: Validate antibodies using Mfn2 knockout tissues/cells as negative controls. Consider generating epitope-tagged recombinant proteins when possible.

  • In vivo delivery for functional studies:

    • Challenge: Delivering recombinant Mfn2 protein to cells or tissues for functional rescue experiments.

    • Solution: Explore cell-penetrating peptide fusions, liposomal delivery systems, or AAV-mediated expression for efficient delivery to target tissues.

By anticipating and addressing these technical challenges, researchers can improve the reliability and reproducibility of experiments involving recombinant Mfn2.

How can I reconcile conflicting data on the metabolic effects of Mfn2 mutations?

Reconciling conflicting data on the metabolic effects of Mfn2 mutations requires systematic evaluation of methodological differences, genetic factors, and environmental influences:

  • Critical assessment of experimental models:

    • Compare knockout versus knockin approaches (complete absence vs. mutation)

    • Evaluate tissue-specific versus global mutation models

    • Consider developmental timing (germline mutations vs. inducible adult mutations)

    • Examine age of analysis, as phenotypes may develop progressively

  • Strain and genetic background considerations:

    • Different mouse strains may have varying metabolic baselines and responses

    • Genetic modifiers present in some backgrounds may mask or enhance phenotypes

    • Back-crossing to a common background or using multiple backgrounds can provide clarity

  • Environmental and experimental standardization:

    • Diet composition (standard chow vs. high-fat) significantly impacts metabolic phenotypes

    • Housing conditions (temperature, light cycles) affect metabolic parameters

    • Standardize metabolic testing protocols (fasting duration, time of day for measurements)

  • Resolution through complementary approaches:

    • Combine in vivo physiological measurements with ex vivo and in vitro analyses

    • Use pharmacological approaches to complement genetic models

    • Compare acute versus chronic effects of Mfn2 dysfunction

  • Data integration framework:

    Experimental ApproachStrengthsLimitationsBest Applications
    Global Mfn2 knockoutComplete loss of functionEmbryonic lethality limits adult studiesDevelopmental mechanisms
    Conditional tissue-specific knockoutAllows study of adult phenotypesMay have compensatory changesTissue-specific functions
    Mfn2 R707W knockinModels human disease mutationMay have milder phenotype than humanTranslational studies
    Acute Mfn2 depletion (siRNA, CRISPRi)Avoids developmental compensationLimited to accessible cells/tissuesDirect vs. adaptive effects
    Pharmacological mitochondrial stressCan be applied to multiple modelsPotential off-target effectsMechanism validation
  • Analysis of secondary versus primary effects:

    • Some metabolic changes may be compensatory rather than directly caused by Mfn2 dysfunction

    • Time-course studies can help distinguish primary from secondary effects

    • Molecular markers of direct Mfn2 targets versus downstream pathways

For example, the R707W mutation in Mfn2 causes severe metabolic disease in humans but milder effects in mice . This discrepancy might be explained by species-specific differences in adipose biology, the duration of exposure to the mutation, or environmental factors like diet and physical activity.

What are emerging technologies that might advance Mfn2 research?

Several cutting-edge technologies are poised to significantly advance Mfn2 research in the coming years:

  • Cryo-electron microscopy for structural biology:

    • High-resolution structures of full-length Mfn2 and its disease-causing mutants

    • Visualization of Mfn2 oligomers during different stages of the fusion process

    • Structure-guided drug design for targeting specific Mfn2 functions

  • Single-cell omics approaches:

    • Single-cell RNA sequencing to identify cell type-specific responses to Mfn2 mutation

    • Spatial transcriptomics to map Mfn2-related gene expression changes within tissues

    • Single-cell proteomics and metabolomics to characterize cellular heterogeneity

  • Advanced imaging technologies:

    • Super-resolution microscopy (STORM, PALM) for visualizing mitochondrial dynamics below the diffraction limit

    • Live-cell volumetric imaging with lattice light-sheet microscopy

    • Correlative light and electron microscopy (CLEM) to link functional observations with ultrastructural details

  • Genome engineering advances:

    • Base editing and prime editing for precise introduction of Mfn2 mutations without double-strand breaks

    • Multiplexed CRISPR screens to identify genetic modifiers of Mfn2 function

    • Inducible, reversible, and tissue-specific gene editing systems

  • Organoid and tissue engineering models:

    • Adipose tissue organoids from wild-type and Mfn2 mutant stem cells

    • Multi-tissue microfluidic systems to study inter-organ communication

    • Engineered tissues with defined mutations for drug screening

  • In situ structural biology:

    • Proximity labeling approaches (BioID, APEX) to map Mfn2 interaction networks in specific cellular contexts

    • In-cell NMR and cross-linking mass spectrometry to study conformational changes and protein dynamics

These technologies will provide unprecedented insights into how Mfn2 mutations affect mitochondrial function and cellular homeostasis, potentially leading to new therapeutic approaches for Mfn2-related disorders.

How might recombinant Mfn2 be used therapeutically in the future?

Recombinant Mfn2 holds potential for therapeutic applications in several contexts, though significant challenges remain in translating these approaches to clinical use:

  • Direct protein replacement therapy:

    • Development of recombinant Mfn2 with enhanced stability and cellular penetration

    • Targeted delivery systems such as lipid nanoparticles or cell-penetrating peptide fusions

    • Tissue-specific targeting to address conditions like Charcot-Marie-Tooth type 2A neuropathy

  • Small molecule modulation of Mfn2 activity:

    • Screening of compound libraries using recombinant Mfn2 to identify activators for loss-of-function conditions

    • Development of inhibitors for contexts where Mfn2 hyperactivity contributes to pathology

    • Allosteric modulators that selectively affect specific functions of Mfn2

  • Gene therapy approaches:

    • AAV-mediated delivery of wild-type Mfn2 to affected tissues

    • CRISPR-based correction of specific mutations like R707W

    • Antisense oligonucleotides to modulate Mfn2 splicing or expression

  • Cell-based therapies:

    • Engineered stem cells with optimized Mfn2 function for tissue regeneration

    • Ex vivo correction of patient-derived cells followed by autologous transplantation

    • Mitochondrial transplantation to restore function in Mfn2-deficient tissues

  • Targeting downstream pathways:

    • Modulation of the integrated stress response activated by Mfn2 dysfunction

    • Restoration of adipokine secretion in conditions like lipodystrophy

    • Mitochondrial metabolism enhancers to compensate for fusion defects

  • Personalized medicine approaches:

    • Mutation-specific therapies based on functional characterization of variants

    • Biomarker-guided treatment selection based on ISR activation or other molecular signatures

    • Combinatorial approaches targeting multiple aspects of Mfn2-related pathology

These therapeutic strategies would first need to be validated in animal models like the Mfn2 R707W mice before clinical translation, with careful consideration of potential off-target effects and tissue-specific requirements.

What key questions remain unanswered about mouse Mfn2 function?

Despite significant advances in understanding Mfn2 function, several critical questions remain unanswered and represent important areas for future research:

  • Tissue-specific functions and requirements:

    • Why does the R707W mutation cause adipose-specific effects rather than uniform mitochondrial dysfunction across all tissues?

    • What tissue-specific cofactors or regulators determine Mfn2's function in different cell types?

    • How do compensatory mechanisms differ between tissues in response to Mfn2 dysfunction?

  • Molecular mechanism of the R707W mutation:

    • How does this specific mutation alter Mfn2's GTPase activity, protein interactions, or conformation?

    • Why does R707W uniquely cause lipodystrophy while other MFN2 mutations primarily cause neuropathy?

    • What is the structural basis for the mutation's effect on mitochondrial morphology?

  • Species-specific differences in phenotypic manifestation:

    • Why do mice with the R707W mutation not develop the severe lipodystrophy seen in human patients?

    • What molecular or physiological differences between mouse and human adipose tissue explain this discrepancy?

    • Can humanized mouse models better recapitulate the human disease phenotype?

  • Integrated stress response activation mechanisms:

    • How does mitochondrial dysfunction caused by Mfn2 mutation trigger the integrated stress response?

    • Which arm of the ISR (PERK, GCN2, PKR, or HRI) is primarily activated by Mfn2 dysfunction?

    • Is ISR activation a protective or pathological response in this context?

  • Non-mitochondrial functions of Mfn2:

    • What is the significance of Mfn2's association with α-tubulin during oocyte maturation?

    • Does Mfn2 have direct signaling functions beyond its role in mitochondrial fusion?

    • How does Mfn2 coordinate with other cellular stress response pathways?

  • Developmental and reproductive roles:

    • How does maternal Mfn2 in oocytes influence early embryonic development?

    • What role does Mfn2 play in mitochondrial inheritance during reproduction?

    • How do Mfn2 mutations affect fertility and transgenerational health?

Addressing these questions will require innovative approaches combining genetic, biochemical, and physiological studies, potentially leading to new insights into mitochondrial biology and novel therapeutic strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.