Recombinant Mouse Monocyte to macrophage differentiation factor 2 (Mmd2)

Shipped with Ice Packs
In Stock

Description

Expression and Localization

Mmd2 is expressed during early testis development in mice, specifically in Sertoli cells, which orchestrate testicular organization . It localizes to the Golgi apparatus, where it modulates signaling pathways critical for growth and differentiation .

Functional Redundancy with PAQR Family Members

Knockout studies in mice revealed minimal phenotypic effects, suggesting functional redundancy with other PAQR genes:

GeneRoleInteraction with Mmd2
MmdCardiac development in zebrafish; potential redundancy in miceOverlapping expression in gonads
Paqr8Gonadal development in miceCo-expressed during sex determination

Double knockouts of Mmd2;Mmd or Mmd2;Paqr8 showed no defects in testis development, underscoring compensatory mechanisms .

Signaling Pathway Interactions

Mmd2 interacts with:

  • PAQR3: Regulates Ras signaling by sequestering Raf1, modulating ERK phosphorylation .

  • Rho GTPases: Influences actin cytoskeleton dynamics, impacting cell motility and growth .

Knockdown of LvMmd2 in shrimp upregulated muscle-related genes (e.g., myosin, actin), highlighting conserved roles in growth regulation .

Experimental Uses

Recombinant Mmd2 is employed in:

  1. Protein-Protein Interaction Assays: Co-immunoprecipitation (Co-IP) and yeast two-hybrid (Y2H) studies to map binding partners (e.g., PAQR3, Rho) .

  2. Cellular Differentiation Models: Studying monocyte-to-macrophage transition, particularly in HIV latency reactivation .

  3. Structural Analysis: X-ray crystallography or cryo-EM to resolve Golgi-associated conformations.

Challenges in Functional Studies

  • Redundancy: Overlapping functions with Mmd and Paqr8 complicate phenotypic analysis .

  • Species-Specific Roles: Human MMD2’s role in Golgi-Ras signaling may not fully align with murine Mmd2’s testis-specific functions .

Future Directions

  1. Targeted Knockouts: Conditional Mmd2 ablation in specific cell lineages (e.g., Sertoli cells) to isolate its role.

  2. Therapeutic Potential: Exploiting Mmd2’s interaction with Ras/PAQR3 pathways for modulating cancer or immune-related diseases.

  3. High-Throughput Screening: Using recombinant Mmd2 to identify small-molecule modulators of PAQR signaling.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently available in our inventory. However, if you have specific requirements for the format, kindly indicate your preference in the order remarks. We will prepare the product according to your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Mmd2; Paqr10; Monocyte to macrophage differentiation factor 2; Progestin and adipoQ receptor family member 10; Progestin and adipoQ receptor family member X
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Mmd2
Target Protein Sequence
MFTLARLLDFQKTKYARFMNDRVPAHKRYQPTEYEHAANCATHAFWIIPSILGSSNLYFL SDDDWETISAWIYGLGLCGLFVVSTIFHTVSWKKSHLRMVEHCLHMIDRMVIYFFIAASY APWLNLRELGPWASHMRWLVWIMASIGTIYVFFFHERYKLVELLCYVVMGFFPALVILSM PNTDGIWELMTGGAFYCLGMVFFKSDGRIPFAHAIWHLFVAFGAGTHYYAIWRYLYLPST LQTKVSK
Uniprot No.

Target Background

Gene References Into Functions
  1. Identification of progestin & adipoQ receptor, PAQR10, in a screen for genes differentially expressed in pancreatic beta-cells; propose PAQR10 may act at the level of the mitochondrion to regulate pancreatic endocrine cell development/survival PMID: 18769639
Database Links
Protein Families
ADIPOR family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is Mmd2 and what protein family does it belong to?

Mmd2 (Monocyte to Macrophage Differentiation factor 2) is a gene that encodes a member of the progestin and adipoQ receptor (PAQR) family. It is specifically expressed during the sex-determining period in XY (male) but not XX (female) gonads, suggesting a specific role in testis development . The PAQR family consists of membrane proteins with roles in various cellular processes, and Mmd2 represents one member of this family with potential importance in gonadal development .

What is the expression pattern of Mmd2 during development?

Mmd2 exhibits a sexually dimorphic expression pattern during mouse embryonic development. RT-qPCR analysis has shown that Mmd2 mRNA is undetectable in XX gonads at all developmental stages from 10.5 to 15.5 days post coitum (dpc), whereas XY gonads show an increasing level of mRNA from 10.5 dpc to 15.5 dpc . Whole-mount in situ hybridization (WISH) confirms these findings, with no expression evident in the ovaries but progressively increasing expression in the developing testis from around 11.5 dpc, localizing specifically to the testis cords .

In which cell types is Mmd2 expressed during gonadal development?

Mmd2 is specifically expressed in the Sertoli cell lineage within the developing testis. This has been determined through multiple experimental approaches. In situ hybridization signals indicate that Mmd2 marks Sertoli cells positioned between the central germ cells and the peripheral layer of myoid cells in the testis cords . Studies using the We mouse strain (harboring a mutation in c-kit that results in gonads lacking germ cells but retaining somatic cells) showed no difference in Mmd2 expression between wild type and We XY gonads, confirming its expression in somatic cells rather than germ cells . Further confirmation came from studies using the Wt1-RG red green reporter mouse strain, which allowed identification of Mmd2 expression in Sertoli cells that show strong expression of the RG reporter proteins and markers including Sox9 and Amh .

What genetic manipulation methods are effective for studying Mmd2 function?

CRISPR/Cas9 technology has proven effective for generating mouse strains deficient in Mmd2 and its related PAQR family members. Researchers have successfully created single knockout mouse models for Mmd2, as well as for the related genes Mmd and Paqr8 . To investigate potential functional redundancy among these genes, double knockout lines (Mmd2;Mmd and Mmd2;Paqr8) have also been generated . These genetic models allow for comprehensive functional analysis through various phenotypic assays including quantitative RT-PCR and immunofluorescence to assess the effects on sex determination and gonadal development.

What techniques are recommended for analyzing Mmd2 expression patterns?

Multiple complementary techniques are recommended for a comprehensive analysis of Mmd2 expression:

  • Quantitative RT-PCR (RT-qPCR): Provides precise quantification of Mmd2 mRNA levels across different developmental stages and between male and female gonads .

  • Whole-mount in situ hybridization (WISH): Allows visualization of spatial expression patterns within intact gonads, showing the localization of Mmd2 to specific structures like testis cords .

  • Section in situ hybridization: Provides higher resolution of cellular expression patterns, helping identify specific cell types expressing Mmd2 within tissue cross-sections .

  • Reporter mouse models: Using transgenic reporter lines like the Wt1-RG mouse strain enables sorting and identification of specific cell populations (Sertoli, Leydig, germ cells) through fluorescence markers, facilitating precise determination of which cell types express Mmd2 .

How can researchers determine the position of Mmd2 in gene regulatory networks?

To position Mmd2 within gene regulatory networks, researchers can employ several strategic approaches:

  • Analysis of knockout mice deficient in known sex-determining genes: Studies have shown that Mmd2 operates downstream of established sex-determining genes such as Sox9 and Nr5a1 by analyzing Mmd2 expression in Sox9 and Nr5a1 knockout mice .

  • Temporal expression analysis: Comparing the timing of Mmd2 expression with that of other sex-determining genes helps establish the sequence of gene activation during sex determination .

  • Cell-specific expression correlation: Determining which genes are co-expressed with Mmd2 in specific cell types (e.g., Sertoli cells) can reveal potential regulatory relationships .

  • Chromatin immunoprecipitation (ChIP): This technique can identify direct binding of transcription factors to the Mmd2 promoter region, establishing direct regulatory relationships.

How should researchers address potential functional redundancy among PAQR family members?

To address functional redundancy among PAQR family members, researchers should consider:

  • Generating multiple gene knockouts: As demonstrated in the studies, creating double knockout lines (Mmd2;Mmd and Mmd2;Paqr8) can help address potential redundancy between pairs of related genes . Expanding to triple or quadruple knockouts may be necessary if redundancy extends beyond the tested gene pairs.

  • Conditional and tissue-specific knockouts: Using Cre-lox systems to delete genes in specific cell types (e.g., Sertoli cell-specific deletion) at precise developmental time points may reveal phenotypes masked in germline knockouts.

  • Dominant negative approaches: Expressing modified versions of PAQR proteins that interfere with the function of multiple family members simultaneously could overcome redundancy issues.

  • Transcriptome analysis: Comparing gene expression profiles between wild-type and knockout models may reveal compensatory changes in other genes that explain the lack of phenotype.

What methodological challenges exist in studying Mmd2's role in sex determination?

Several methodological challenges complicate the study of Mmd2's role in sex determination:

  • Functional redundancy: As demonstrated by the normal development in single and double knockout models, potential redundancy among PAQR family members necessitates complex genetic approaches .

  • Temporal specificity: The dynamic expression pattern of Mmd2 during development requires precise timing of experimental interventions to capture its function .

  • Cell type specificity: The restriction of Mmd2 expression to Sertoli cells means that whole-gonad approaches may dilute signals from this specific cell population .

  • Subtle phenotypes: Sex determination involves multiple parallel pathways, and disruption of Mmd2 may lead to subtle phenotypes that require sophisticated detection methods beyond gross morphological assessment.

How do findings on Mmd2 relate to human disorders of sex development?

The research on Mmd2 and related PAQR genes has implications for understanding human disorders/differences of sex development (DSD). The difficulties in identifying functional roles for these genes through expression screening and loss-of-function analyses may help explain the relative paucity of genes in which variations have been found to cause human DSD . The potential functional redundancy among PAQR factors or their dispensability in gonadal development despite specific expression patterns highlights the complexity of sex determination pathways and suggests that human DSD may similarly involve complex genetic interactions rather than simple single-gene disorders .

What alternative experimental approaches might reveal Mmd2 function beyond knockout studies?

Given the limitations of knockout approaches, researchers should consider alternative strategies:

  • Gain-of-function studies: Overexpression of Mmd2 in XX gonads (where it is normally absent) might reveal functions not apparent in loss-of-function models.

  • Structure-function analysis: Creating chimeric proteins by swapping domains between different PAQR family members could identify functional domains specific to Mmd2.

  • Protein interaction studies: Identifying Mmd2-interacting proteins through co-immunoprecipitation, yeast two-hybrid, or proximity labeling approaches may reveal its functional networks.

  • Environmental or hormonal challenges: Exposing knockout models to hormonal perturbations or environmental stressors might unmask phenotypes not visible under standard laboratory conditions.

  • Long-term aging studies: Some gene functions may only become apparent in aged animals, so extended studies beyond embryonic development could reveal later phenotypes.

What can be learned from comparing Mmd2 with monocyte-to-macrophage differentiation processes?

Monocyte-to-macrophage differentiation involves significant changes in the expression of extracellular matrix (ECM) components. For example, differentiation is associated with substantial increases in mRNA for TNF-stimulated gene-6, HAS2 (responsible for hyaluronan synthesis), and versican (which interacts with hyaluronan) . These changes suggest major ECM remodeling during differentiation. Similarly, the sex-specific expression of Mmd2 in developing testes occurs during a period of significant tissue remodeling and reorganization . This parallel raises the possibility that Mmd2 might have conserved functions related to cellular differentiation and tissue remodeling in both contexts, potentially involving interaction with or regulation of ECM components.

What controls are essential when performing expression and functional studies of Mmd2?

When studying Mmd2, several critical controls should be implemented:

  • Sex-matched controls: Given Mmd2's sex-specific expression, comparisons must always include properly sex-matched controls (XX vs. XX and XY vs. XY) .

  • Developmental stage matching: The dynamic expression of Mmd2 during development necessitates precise developmental staging for valid comparisons .

  • Cell type controls: When studying Sertoli cell-specific expression, appropriate cell type markers (Sox9, Amh) should be included as positive controls .

  • Germ cell-deficient models: Models like the We mouse strain provide valuable controls to distinguish between expression in somatic cells versus germ cells .

  • Related gene family controls: Given potential redundancy, expression analysis should include related PAQR family members (Mmd, Paqr8) as comparative controls .

What are the advantages and limitations of different research methods for studying Mmd2?

Understanding the strengths and limitations of different research approaches is crucial for Mmd2 studies:

MethodAdvantagesLimitations
RT-qPCRPrecise quantification of mRNA levels; high sensitivity; ability to analyze multiple samples efficientlyLacks spatial information; requires quality RNA; may not reflect protein levels
Whole-mount in situ hybridizationPreserves spatial context; visualizes expression patterns in intact tissueLower sensitivity than qPCR; qualitative rather than quantitative; technical challenges with probe specificity
CRISPR gene knockoutAllows direct functional assessment; can target specific domains; enables study of gene families through multiple knockoutsPotential off-target effects; compensatory mechanisms may mask phenotypes; time-consuming to generate models
Reporter mouse modelsEnables live tracking of expression; facilitates cell sorting for population-specific analysisLabor-intensive to generate; reporter may not perfectly recapitulate endogenous expression
ImmunofluorescenceDetects protein rather than mRNA; can be combined with other markers for co-localizationDependent on antibody quality; potential cross-reactivity with related proteins; fixation artifacts

How should researchers interpret negative results from Mmd2 functional studies?

The interpretation of negative results (such as the normal phenotype in Mmd2 knockout mice) requires careful consideration:

  • Functional redundancy: The absence of phenotype may reflect compensation by related genes (Mmd, Paqr8, or other PAQR family members) . This possibility should be systematically addressed through multiple gene knockouts or other approaches that overcome redundancy.

  • Experimental sensitivity: The methods used to assess phenotypes may lack the sensitivity to detect subtle changes. More sensitive approaches such as single-cell transcriptomics or detailed histological analysis might reveal phenotypes not apparent at the gross morphological level.

  • Context dependency: Mmd2 function might only be required under specific conditions not replicated in standard laboratory environments. Challenging the system through environmental stressors or genetic sensitization might reveal conditional requirements for Mmd2.

  • Temporal considerations: The timing of analysis might miss transient phenotypes or those that develop later in life. Extended temporal studies might reveal delayed manifestations of Mmd2 deficiency.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.