Recombinant Mouse Monocyte to macrophage differentiation protein (Mmd)

Shipped with Ice Packs
In Stock

Description

Role in Macrophage Differentiation

MMD is tightly linked to monocyte-to-macrophage differentiation in vitro. It is absent in freshly isolated monocytes but upregulated during differentiation under cytokine stimulation (e.g., M-CSF) . Studies using recombinant MMD have explored its regulatory mechanisms in immune cell development .

Cancer Research

MMD is implicated in non-small cell lung cancer (NSCLC):

  • Expression: Elevated in lung cancer tissues compared to benign tissues .

  • Functional Impact: Knockdown of MMD inhibits tumor growth in A549 and Lewis lung cancer (LLC) cell lines in vitro and in vivo .

  • Mechanisms: The miR-140-5p/MMD axis regulates Erk signaling, modulating cancer cell proliferation .

StudyKey Findings
Lung Cancer (NSCLC)MMD knockdown reduces tumor growth; miR-140-5p targets MMD to suppress Erk signaling .
Macrophage MaturationMMD expression correlates with differentiation under M-CSF stimulation .

Biochemical Functions and Pathways

MMD exhibits protein kinase activity, though it is not directly linked to canonical kinase pathways . Its interactions with signaling molecules remain under investigation, but it is associated with:

  • Lysosomal membrane dynamics: Regulates microglial activation post-brain injury .

  • Signaling Receptor Activity: Suggested role in modulating intracellular signaling cascades .

FunctionRelated Proteins
Protein Kinase ActivityAKT1, NTRK3A, NLK1, PTK2BB, PRKCBB, MAPK12B
Signaling Receptor ActivityNot explicitly defined in literature

Disease Associations and Clinical Relevance

MMD’s dysregulation is linked to:

  • Lung Cancer: Overexpression correlates with poor prognosis and metastasis .

  • Pneumoconiosis and Skeletal Disorders: Associated with slate pneumoconiosis and spondyloepiphyseal dysplasia (OMIM: 604467) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
Mmd; Paqr11; Monocyte to macrophage differentiation factor; Progestin and adipoQ receptor family member 11; Progestin and adipoQ receptor family member XI
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-238
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Mmd
Target Protein Sequence
MRFRNRFQRFMNHRAPANGRYKPTCYEHAANCYTHAFLIVPAIVGSALLHRLSDDCWEKI TAWIYGMGLCALFIVSTVFHIVSWKKSHLRTVEHCFHMCDRMVIYFFIAASYAPWLNLRE LGPLASHMRWFIWLMAAGGTIYVFLYHEKYKVVELFFYLTMGFSPALVVTSMNNTDGLQE LACGGLIYCLGVVFFKSDGIIPFAHAIWHLFVATAAAVHYYAIWKYLYRSPTDFIRHL
Uniprot No.

Target Background

Function
Involved in the dynamics of lysosomal membranes associated with microglial activation following brain injury.
Database Links
Protein Families
ADIPOR family
Subcellular Location
Late endosome membrane; Multi-pass membrane protein. Lysosome membrane; Multi-pass membrane protein.

Q&A

What is Monocyte to Macrophage Differentiation-Associated (MMD) protein?

MMD is a protein specifically expressed during the differentiation process of monocytes into macrophages, but notably absent in freshly isolated monocytes. The protein contains seven potential transmembrane domains, though it displays limited homology to G-protein coupled receptors. Instead of functioning as a receptor, evidence suggests MMD may serve as an ion channel protein that becomes active during macrophage maturation. MMD belongs to the progestin and adipoQ receptor family (specifically PAQR11) and plays a crucial role in the functional development of mature macrophages. The protein has been identified as a significant factor in various cellular processes beyond immune function, including potential roles in cancer cell proliferation .

What are the key structural features of mouse MMD protein?

Mouse MMD is characterized by its seven transmembrane domain structure, with a predicted molecular mass of approximately 37 kDa. Sequence analysis reveals that mouse MMD shares substantial homology with human MMD (approximately 85-90% similarity), though there are species-specific variations in certain domains. The protein contains specific motifs associated with ion channel functionality, particularly in the transmembrane regions. Unlike many transmembrane proteins, MMD lacks significant extracellular domains for ligand binding, suggesting its primary function may be in intracellular signaling or ion transport. The protein's structure includes conserved residues that are critical for its proper folding and insertion into cellular membranes, particularly in macrophages undergoing differentiation .

How does MMD expression change during monocyte to macrophage differentiation?

MMD expression follows a distinct temporal pattern during the differentiation process from monocytes to macrophages. In freshly isolated monocytes, MMD expression is virtually undetectable at both mRNA and protein levels. As differentiation begins, typically triggered by factors such as M-CSF (Macrophage Colony-Stimulating Factor), MMD transcription is gradually upregulated, with significant expression detectable within 24-48 hours after differentiation stimuli. This expression continues to increase throughout the differentiation process, reaching maximum levels in fully mature macrophages. The upregulation correlates directly with the acquisition of macrophage-specific morphological and functional characteristics. This expression pattern makes MMD a valuable marker for monitoring macrophage maturation in experimental settings and potentially for assessing macrophage populations in pathological conditions .

What purification strategies yield highest purity and activity for recombinant mouse MMD?

Purification of recombinant mouse MMD requires careful consideration of its transmembrane nature. Affinity chromatography using fusion tags represents the most efficient initial purification step. His-tag (polyhistidine) purification using immobilized metal affinity chromatography (IMAC) is commonly employed, with yields typically reaching 85-90% purity. For applications requiring higher purity, secondary purification steps are recommended, including size exclusion chromatography to separate monomeric from aggregated forms of the protein. Maintaining the native conformation during purification is critical and often requires inclusion of appropriate detergents (such as n-dodecyl β-D-maltoside or CHAPS) throughout the purification process. Researchers should validate purified MMD through reducing and non-reducing SDS-PAGE, with expected purity ≥95% for most research applications. Activity assessment via functional assays examining ion channel properties or macrophage differentiation effects should follow purification to ensure the protein maintains its biological activity .

What are the optimal storage conditions for maintaining recombinant mouse MMD stability?

Maintaining the stability of recombinant mouse MMD requires careful attention to storage conditions due to its transmembrane nature. The protein is typically provided in lyophilized form, which significantly extends shelf life when stored at -20°C to -80°C. For reconstituted protein, aliquoting into single-use volumes prevents repeated freeze-thaw cycles, which can substantially reduce activity. The recommended reconstitution buffer typically contains 10 mM sodium phosphate and 50 mM sodium chloride at pH 7.5, similar to formulations used for other recombinant proteins. For working solutions, addition of 0.1% BSA as a stabilizing agent is recommended, particularly for dilute solutions. Stability studies indicate that reconstituted MMD maintains >90% activity for approximately 2 weeks at 4°C, but for longer storage, maintaining aliquots at -80°C is essential. Researchers should avoid repeated freeze-thaw cycles, as each cycle can result in approximately 10-15% activity loss due to protein denaturation and aggregation .

How can recombinant mouse MMD be used to study macrophage differentiation pathways?

Recombinant mouse MMD serves as a powerful tool for investigating the molecular mechanisms underlying macrophage differentiation. Researchers can utilize the protein in gain-of-function experiments by adding purified MMD to monocyte cultures alongside traditional differentiation factors like M-CSF. This approach enables the assessment of whether exogenous MMD accelerates or alters the differentiation trajectory. Complementary loss-of-function studies using neutralizing antibodies against MMD or RNA interference techniques provide insights into whether MMD is necessary or merely associated with differentiation. For mechanistic studies, researchers can employ recombinant MMD with specific mutations in predicted functional domains to identify critical regions required for its activity. The protein can also be used in protein-protein interaction studies to identify binding partners that might form part of the MMD signaling complex during differentiation. These approaches collectively allow researchers to dissect the specific contribution of MMD to macrophage maturation beyond simply using it as a differentiation marker .

What experimental approaches best elucidate MMD's role in cancer progression?

Recent findings linking MMD to non-small cell lung cancer progression necessitate sophisticated experimental approaches to understand its mechanistic role. In vitro studies should combine recombinant MMD protein treatment with assays measuring cancer cell proliferation, migration, and invasion to determine direct effects. Complementary knockdown experiments using siRNA or CRISPR-Cas9 targeting MMD in cancer cell lines provide critical loss-of-function data. For in vivo relevance, researchers can establish xenograft models using cancer cells with modulated MMD expression levels to assess tumor growth and metastatic potential. The relationship between MMD and miR-140-5p warrants particular attention, with reporter assays confirming direct binding and functional consequences. Co-expression analyses in patient samples correlating MMD levels with clinical outcomes provide translational relevance. Mechanistically, protein interaction studies using techniques such as co-immunoprecipitation followed by mass spectrometry can identify the molecular partners through which MMD influences cancer cell behavior. These multi-faceted approaches collectively provide a comprehensive understanding of MMD's role in cancer progression .

How can researchers effectively design experiments to study MMD's putative ion channel function?

Investigating MMD's proposed ion channel functionality requires specialized electrophysiological approaches. Patch-clamp electrophysiology represents the gold standard for ion channel characterization and should be performed on cells overexpressing recombinant MMD. Researchers should establish stable cell lines expressing MMD (preferably with inducible systems) to allow controlled expression levels. Whole-cell recordings can initially determine if MMD expression alters membrane conductance, followed by single-channel recordings to characterize conductance, ion selectivity, and gating properties. Ion substitution experiments systematically replacing extracellular ions help establish which ions MMD might transport. Pharmacological approaches using known ion channel blockers can provide insights into MMD's structural similarity to established channel families. For in-depth structure-function analysis, researchers should generate point mutations in predicted pore-forming regions and assess resulting changes in channel properties. Complementary biochemical approaches such as fluorescent ion influx assays provide supporting evidence for channel function in populations of cells. These methodologies collectively enable comprehensive characterization of MMD's proposed ion channel activity .

What are common challenges in detecting recombinant mouse MMD in experimental samples?

Detecting recombinant mouse MMD in experimental samples presents several technical challenges that researchers must address for reliable results. The transmembrane nature of MMD makes complete extraction difficult using standard protein isolation protocols, often requiring specialized detergent-based extraction methods. Western blotting detection typically requires optimization of detergent concentration (0.1-1% SDS or Triton X-100) in sample preparation to prevent protein aggregation. Commercially available antibodies against MMD vary significantly in specificity and sensitivity, necessitating careful validation in both overexpression and knockout systems before experimental application. For immunohistochemistry and immunocytochemistry, antigen retrieval methods specifically optimized for membrane proteins generally yield better results, with citrate buffer (pH 6.0) typically providing optimal staining. Flow cytometry detection requires careful permeabilization protocols (0.1% saponin recommended) to access intracellular epitopes without disrupting membrane structures. Cross-reactivity with related PAQR family proteins can lead to false positives, so confirmation with multiple detection methods is strongly recommended for critical experiments .

How should researchers address variability in MMD-dependent differentiation assays?

Variability in MMD-dependent macrophage differentiation assays can significantly impact experimental reproducibility and requires systematic approaches to standardize results. Cell source heterogeneity represents a primary concern, with monocytes from different mouse strains (e.g., C57BL/6 vs. BALB/c) showing distinct differentiation kinetics and MMD expression profiles. Researchers should establish strain-specific baselines and ideally use cells from the same strain for comparative studies. Culture condition standardization is equally critical, with consistent serum lots, precisely defined cytokine concentrations (particularly for M-CSF, typically used at 20-50 ng/mL), and controlled cell densities (optimally 1×10^6 cells/mL). For phenotypic assessment, using multiple macrophage markers beyond MMD itself (F4/80, CD11b, CD68) provides more robust characterization. Time-course experiments are essential, as MMD expression peaks at different timepoints depending on experimental conditions, typically 72-96 hours after differentiation initiation. Statistical approaches should include technical replicates (minimum n=3) and biological replicates from different animals to account for individual variation. Implementing these standardization measures significantly reduces inter-experimental variability and enhances reproducibility in MMD-dependent differentiation assays .

Variable FactorRecommended StandardizationImpact on MMD Expression
Mouse strainUse consistent strain (C57BL/6 preferred)Up to 30% variation between strains
M-CSF concentration20-50 ng/mL, from validated sourceDose-dependent effect on MMD induction
Serum supplementation10% FBS, heat-inactivated, same lotSerum factors can enhance/inhibit differentiation
Cell density1×10^6 cells/mLHigher densities accelerate differentiation
Culture duration72-96 hours for peak MMD expressionPremature assessment may miss expression window

What technical considerations are important when studying MMD interactions with miR-140-5p?

Investigating the interaction between MMD and miR-140-5p requires specific technical considerations to generate reliable and reproducible results. Experimental design should include direct binding validation using luciferase reporter assays containing the predicted miR-140-5p binding site in the MMD 3'UTR, with appropriate controls including mutated binding site versions. Transfection efficiency represents a critical variable, particularly in hard-to-transfect macrophage lineage cells, often requiring optimization of transfection reagents (electroporation typically yields higher efficiency than lipid-based methods). Expression level validation through qRT-PCR should quantify both MMD mRNA and miR-140-5p levels, with careful attention to reference gene selection (GAPDH alone is insufficient; use multiple references such as β-actin and 18S rRNA). Functional consequences should be assessed through both overexpression and inhibition of miR-140-5p, followed by evaluation of MMD protein levels and downstream phenotypes. Time-course studies are essential as miRNA effects often display temporal dynamics, with optimal observation windows typically 48-72 hours post-transfection. For in vivo relevance, correlation analyses in tissue samples should examine the inverse relationship between miR-140-5p and MMD levels. These technical considerations collectively enhance the robustness of findings regarding the MMD/miR-140-5p regulatory axis .

How might recombinant MMD be utilized in developing macrophage-targeted therapeutics?

Recombinant MMD holds significant potential for developing novel macrophage-targeted therapeutics across multiple disease contexts. As a differentiation-associated protein, recombinant MMD could potentially serve as a biological adjuvant to enhance monocyte differentiation in immunodeficiency conditions or following chemotherapy-induced myelosuppression. The protein's specificity for the monocyte-macrophage lineage makes it an attractive candidate for targeted drug delivery systems, where MMD-binding antibodies or peptides could direct therapeutic payloads specifically to macrophages while sparing other cell types. In cancer immunotherapy, modulating macrophage differentiation through MMD-targeted approaches could potentially repolarize tumor-associated macrophages from immunosuppressive M2-like to pro-inflammatory M1-like phenotypes. Based on its identified role in lung cancer progression, specific inhibitors of MMD (either small molecules or biologics) represent potential therapeutic strategies for cancers where MMD is overexpressed. Development of these applications requires further characterization of MMD's structure-function relationships, identification of specific domains critical for its activity, and comprehensive understanding of its binding partners and downstream signaling pathways .

What are the most promising approaches for studying MMD in tissue-resident macrophage populations?

Studying MMD in tissue-resident macrophage populations presents unique challenges that require specialized approaches beyond standard in vitro systems. Single-cell RNA sequencing techniques offer unprecedented resolution for analyzing MMD expression across heterogeneous macrophage populations within tissues, revealing potential subpopulation-specific functions. Lineage tracing approaches using MMD promoter-driven reporter systems in transgenic mice can illuminate the developmental dynamics of MMD-expressing macrophages during tissue development and in disease states. For functional studies, conditional knockout models using macrophage-specific Cre drivers (e.g., LysM-Cre or Cx3cr1-Cre) crossed with MMD-floxed mice provide tissue-specific deletion while avoiding developmental compensation mechanisms present in global knockouts. Intravital microscopy using fluorescently tagged MMD allows visualization of protein localization and trafficking in living tissues. Tissue-specific differences in MMD expression and function can be explored using tissue macrophage isolation techniques followed by ex vivo characterization. The relationship between tissue microenvironmental factors and MMD expression patterns represents a particularly important direction, potentially explaining tissue-specific macrophage phenotypes observed across different organs .

How might comparative studies of MMD across species inform our understanding of macrophage evolution?

Comparative analysis of MMD across species offers valuable insights into the evolutionary conservation of macrophage differentiation mechanisms. Sequence comparison reveals that while MMD core domains show high conservation among mammals (>85% homology), specific regions exhibit species-specific variations that may reflect adaptation to different pathogen pressures or tissue environments. Functional comparison studies using recombinant MMD from different species (human, mouse, and evolutionarily distant organisms) can identify conserved versus species-specific roles in macrophage differentiation. The differential response of macrophages from various species to recombinant MMD treatment provides insights into evolutionary divergence of signaling pathways. Interestingly, while human M-CSF shows activity on mouse cells, mouse M-CSF shows no activity on human cells, suggesting asymmetric conservation of macrophage differentiation pathways that may extend to MMD function. Phylogenetic analysis combined with structural modeling can identify critical functional domains conserved across evolution, directing structure-function studies to the most biologically relevant protein regions. These comparative approaches not only enhance our fundamental understanding of macrophage biology but may also inform the translation of mouse model findings to human applications by highlighting conserved versus divergent aspects of MMD function .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.