Recombinant Mouse Motile sperm domain-containing protein 2 (Mospd2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped on blue ice unless otherwise requested. Dry ice shipping is available upon advance request and will incur additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Mospd2; Motile sperm domain-containing protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-518
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Mospd2
Target Protein Sequence
MAENNAQNKAKLISETRRRFEAEYVTEKSEKYDSRDVERLQQDDNWVESYLYWRHNVVDE TLKMLDESFQWRKEFSVNDLSESSIPRWLLELGGIYLHGYDKEGNKLFWIRVKYHIKDQK TIMDKKKLIAFWLERYAKRENGKPITVMFDMSETGLNSIDMDFVRFIINCFKVYYPKYLS KIVIFDMPWIMNAAFKIVKSWLGPEAVSLLKFTSKNEIQEYVSVEYLPPHMGGTDPFKYS YPPLVDDDFQTPLCENGPIASEDETSSKEDIEGDGKETLETISNEEPPALSEKSNPTESV SKKDENEKVDSKTKTFKKPLSVFKGPLLHISPAEELYFGSIESGEKKTLIVLTNVTKNIV AFKVRTTAPEKYRVKPSNSSCDPGASIDIIVSPHGGLTVSAQDRFLIMAAEMEQSSGTGP AELSQFWKEVPRNKVMEHRLRCHTVESSKPNSLMLKDSISTMSDKTSEDLYLQLNRLLES NRKLEDQLQRSIWFQQLLLALTMVLLDFVVSFFYSLYN
Uniprot No.

Target Background

Function

Motile sperm domain-containing protein 2 (MOSPD2) is an endoplasmic reticulum-anchored receptor that modulates interorganelle contacts. It achieves this by interacting with other organelle-bound proteins via their FFAT motifs. MOSPD2 may play a significant role in endoplasmic reticulum-endosome interactions. Furthermore, it promotes the migration of primary monocytes and neutrophils in response to various chemokines.

Database Links
Subcellular Location
Endoplasmic reticulum membrane; Single-pass type IV membrane protein.

Q&A

What is MOSPD2 and what are its primary cellular functions?

MOSPD2 (Motile Sperm Domain-Containing Protein 2) serves two major functions in cells. First, it acts as a novel scaffold for endoplasmic reticulum (ER) membrane contact sites, interacting with FFAT (two phenylalanines in an acidic tract) motif-containing tether proteins from endosomes, mitochondria, and Golgi, thereby mediating the formation of contact sites between the ER and these organelles . Second, it plays a critical role in regulating monocyte migration in response to various chemokines, with silencing or neutralizing MOSPD2 in monocytes restricting their migration regardless of the activating chemokine .

What are the key structural domains of MOSPD2 and how do they relate to its function?

MOSPD2 contains two primary functional domains:

  • MSP (Major Sperm Protein) domain - Similar to VAP proteins, this domain specifically binds to FFAT motifs in partner proteins, facilitating membrane contact site formation .

  • CRAL-TRIO domain (spanning amino acids 82-239) - The CRAL region binds and transports phospholipids, while the TRIO region functions as a guanine exchange factor that interacts with small GTPase proteins (Rho, Ras, and Rac), which are known regulators of cell migration .

DomainLocationFunctionAssociated Partners
MSPC-terminalFFAT motif bindingTether proteins from organelles
CRAL-TRIOaa 82-239Phospholipid binding/GTPase interactionPotentially small GTPases

Where is MOSPD2 expressed in the immune system?

MOSPD2 expression shows cell-type specificity within the immune system. It is prominently expressed on the cytoplasmic membrane of human monocytes and to a lesser extent in neutrophils. Notably, MOSPD2 is not detected in lymphocytes, suggesting its functions may be specific to the myeloid lineage . This expression pattern correlates with MOSPD2's role in promoting migration of myeloid cells but not lymphocytes.

How can recombinant mouse MOSPD2 be produced for experimental studies?

For producing recombinant MOSPD2, researchers can employ several approaches depending on whether full-length protein or specific domains are needed:

  • For isolated domains (e.g., MSP domain): Express and purify from Escherichia coli bacterial expression systems .

  • For full-length tagged protein: Insert full-length MOSPD2 cDNA into lentiviral plasmid vectors (e.g., pLVX-EF1α-IRES-Puro), add appropriate tags (e.g., hemagglutinin/HA tag), and transduce mammalian cell lines. This approach was demonstrated with A2058 melanoma line cells to generate HA-tagged recombinant human MOSPD2 .

The choice between these methods depends on downstream applications—bacterial expression provides higher yields but may lack post-translational modifications, while mammalian expression preserves native protein structure.

What experimental approaches can verify MOSPD2-dependent membrane tethering?

In vitro tethering assays using recombinant MSP domain and liposomes provide direct evidence of MOSPD2's tethering function. The protocol involves:

  • Prepare two liposome populations:

    • LA liposomes bearing FFAT-containing peptides (attached via covalent link with thiol-reactive MPB-PE lipids, 3 mol%)

    • LB liposomes covered by the MSP domain of MOSPD2 (bound via C-terminal 6His-tag attached to DOGS-NTA-Ni²⁺ lipids, 2 mol%)

  • Mix LA and LB liposomes with the MSP domain of MOSPD2

  • Monitor tethering using dynamic light scattering (DLS) to measure particle size changes

    • Initial mean radius: ~80 nm

    • After MSP addition: rapid increase up to 600 nm

    • Final state: formation of liposome aggregates with high polydispersity (479 ± 87 nm)

  • Control experiment: Use RD/LD MSP mutant (unable to bind FFAT) - no aggregation observed

This approach directly demonstrates MOSPD2's ability to bridge membrane structures through its FFAT-binding activity.

How can anti-MOSPD2 antibodies be generated and validated for research?

Two primary approaches for generating anti-MOSPD2 antibodies are:

  • Polyclonal antibodies:

    • Immunize rabbits with ~0.5 mg HA-recombinant human MOSPD2 emulsified in CFA

    • Administer three boosts (~0.25 mg in IFA) every 3 weeks

    • Collect serum 1 week after each boost

    • Isolate antibodies using protein A/G beads

  • Monoclonal antibodies:

    • Use platforms like HuCAL PLATINUM (Bio-Rad)

    • Incubate human antibody library (Fab format on phage particles) with immobilized MOSPD2 protein

    • Perform three panning rounds with washing and elution steps

    • Subclone enriched antibody DNA into expression vectors

    • Generate bivalent F(ab')2 fragments in E. coli

    • Screen cultures for specific antigen binding by ELISA

    • Convert positive clones to full IgG1 mAbs via transfection with Fc-adding vector

Validation methods include ELISA specificity testing and flow cytometry on cells overexpressing human MOSPD2 .

How does MOSPD2 mediate membrane contact site formation?

MOSPD2 functions as a tethering component that bridges the ER with various organelles through a specific molecular mechanism:

  • MOSPD2 anchors to the ER membrane through its transmembrane domain

  • Its MSP domain specifically binds to FFAT motifs present in partner proteins located on target organelles (endosomes, mitochondria, or Golgi)

  • This binding creates physical bridges between the ER and the target organelle, maintaining a defined spacing that restricts the recruitment of specific tethering complexes

  • The spacing between membranes must be compatible with the size of the protein complex mediating attachment

  • MOSPD2 contributes to the formation of ER-endosome contacts independently from VAP proteins, suggesting non-redundant functions

The identification of MOSPD2 as a FFAT-binding protein supports the idea that membrane contact sites rely on highly redundant mechanisms with diverse tethering complexes present within zones of apposition .

What is the mechanism by which MOSPD2 regulates monocyte migration?

MOSPD2 promotes monocyte migration through specific signaling pathways:

  • Upon chemokine receptor ligation, MOSPD2 facilitates downstream signaling events

  • Silencing MOSPD2 impairs monocyte migration induced by different chemokines

  • Mechanistically, MOSPD2 silencing inhibits ERK and AKT phosphorylation following chemokine receptor activation

  • This effect is not due to alterations in chemokine receptor surface expression

  • The inhibition is specific to migration, as other functions like proliferation and priming with IFN-γ or protein kinase C remain intact in MOSPD2-silenced cells

While the precise molecular mechanism remains to be fully elucidated, it's hypothesized that MOSPD2 may pair with chemokine receptors or other surface membrane proteins to serve as a co-receptor necessary for full activation of chemokine signaling .

How can researchers experimentally distinguish between VAP and MOSPD2 functions?

Both VAP proteins and MOSPD2 contain MSP domains that bind FFAT motifs, yet they exhibit distinct functional roles that can be distinguished through:

  • Site-directed mutagenesis:

    • VAP-A/B KD/MD mutations (K94D/M96D for VAP-A, K87D/M89D for VAP-B) disrupt FFAT binding

    • MOSPD2 RD/LD mutation (R404D/L406D) similarly abolishes FFAT binding

    • These mutants serve as valuable tools to dissect specific functions

  • Cell-type specific analysis:

    • MOSPD2 contributes to ER-endosome contacts independent of VAP proteins

    • In contrast to VAP-B, MOSPD2 does not participate in steady-state levels of ER-mitochondria contacts

  • Silencing experiments:

    • MOSPD2 silencing specifically reduces ER-endosome contacts while increasing endosome-endosome contacts

    • This phenotype differs from VAP silencing effects

These approaches reveal context-dependent requirements for VAP proteins versus MOSPD2 in membrane contact site formation, highlighting their non-redundant functions.

What phenotypes are observed in MOSPD2 knockout mice?

MOSPD2 knockout mice have been generated and characterized:

  • Generation strategy: Targeted deletion of exons 4-5 in the MOSPD2 gene

  • Verification methods:

    • PCR genotyping

    • Southern blot analysis

    • Western blot confirmation of protein ablation in spleen, bone marrow, and thymus cells

  • Developmental phenotype:

    • Born at expected Mendelian ratios

    • Develop normally

  • Immune system architecture:

    • Lymphoid tissues and cell populations remain intact

These findings suggest that while MOSPD2 has important functions in immune cell migration, its absence is not lethal and does not disrupt basic immune system development, making it a potentially suitable therapeutic target.

What evidence supports MOSPD2 as a therapeutic target for inflammatory conditions?

Multiple lines of evidence support MOSPD2 as a promising therapeutic target:

  • Functional specificity:

    • MOSPD2 regulates migration of monocytes and, to some extent, neutrophils

    • It does not affect lymphocyte migration, allowing for targeted intervention

    • This specificity could limit off-target effects on adaptive immunity

  • Disease relevance:

    • Animal models implicate monocytes and neutrophils in the pathogenesis of inflammatory diseases and cancer metastasis

    • MOSPD2 plays a key role in regulating migration of inflammatory monocytes

  • Intervention strategies:

    • Anti-MOSPD2 antibodies constitute a potential therapeutic approach for CNS inflammation

    • The availability of monoclonal antibodies against MOSPD2's extracellular region provides ready therapeutic candidates

  • Migration-specific effects:

    • MOSPD2 targeting specifically inhibits migration without affecting other cellular functions like proliferation

    • This suggests potentially fewer side effects than broad immunosuppressive approaches

These characteristics position MOSPD2 as a potential target for treating diseases where monocyte and neutrophil accumulation drives pathogenesis.

How can mass spectrometry be optimized for MOSPD2 interaction studies?

For researchers investigating MOSPD2 interactions, mass spectrometry offers powerful analytical capabilities when properly optimized:

  • Sample preparation protocol:

    • Precipitate protein complexes from cell lysates

    • Resolve samples on SDS-PAGE gel

    • Visualize using Imperial Protein Stain

    • Cut gel lanes into multiple pieces for comprehensive analysis

    • Digest samples with trypsin

  • Analytical parameters:

    • LC-MS/MS analysis on LTQ-Orbitrap mass spectrometer

    • Identify proteins using Discoverer software (version 1.3)

    • Search against human SWISS-PROT database using Mascot search engine

  • Scoring considerations:

    • Standard score: cumulative protein score based on summing unique peptide ion scores

    • MudPIT score: sum of ion excess scores over homology/identity threshold

    • The Proteome Discoverer application automatically alternates between scoring methods

  • Validation approach:

    • Confirm interactions by immunoblotting lysates with specific antibodies

    • Include appropriate controls (e.g., comparing specific vs. non-specific binding)

This methodological approach allows for robust identification of MOSPD2 binding partners and protein complexes.

What signaling networks are affected downstream of MOSPD2 in monocytes?

MOSPD2 influences specific signaling networks in monocytes that govern chemotactic responses:

  • Direct signaling effects:

    • MOSPD2 silencing impairs ERK and AKT phosphorylation following chemokine receptor ligation

    • This effect occurs regardless of which specific chemokine is used

  • Receptor independence:

    • The inhibition is not due to altered chemokine receptor surface expression

    • Suggests MOSPD2 functions downstream of receptor engagement or as a co-receptor

  • Functional specificity:

    • MOSPD2 specifically affects migration pathways

    • Other cellular functions (proliferation, IFN-γ or PKC priming) remain intact

  • Potential mechanistic model:

    • MOSPD2 may pair with chemokine receptors or other surface proteins

    • This pairing could form a complex necessary for full activation of chemokine receptors

    • The TRIO region might mediate MOSPD2's effect on cell motility through small GTPase interactions

Understanding these networks provides opportunities to develop targeted approaches to modulate specific aspects of monocyte function in disease contexts.

What considerations should researchers take when designing MOSPD2 domain mutation studies?

When designing studies to investigate MOSPD2 domain functions through mutations:

  • Critical MSP domain residues:

    • The R404D/L406D (RD/LD) mutation abolishes FFAT binding

    • This mutation parallels the K94D/M96D and K87D/M89D mutations in VAP-A and VAP-B

    • These sites represent crucial experimental targets for structure-function studies

  • CRAL-TRIO domain considerations:

    • The CRAL region (within aa 82-239) likely binds phospholipids

    • The TRIO region interacts with small GTPases involved in migration

    • Mutations disrupting these specific interactions should be designed based on structural predictions

  • Functional validation approaches:

    • In vitro binding assays with FFAT peptides

    • Liposome tethering assays to assess membrane contact functions

    • Cell migration assays to evaluate effects on monocyte motility

    • Intracellular signaling analysis (ERK/AKT phosphorylation)

  • Topological constraints:

    • Sequence analysis predicts MOSPD2 lacks a cytoplasmic tail

    • This constrains how mutations might affect downstream signaling

    • Consider how mutations might alter protein-protein interactions rather than direct signaling

These considerations provide a framework for designing mutation studies that can dissect the specific contributions of MOSPD2 domains to its diverse cellular functions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.