Recombinant Mouse Mpv17-like protein 2 (Mpv17l2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a useful reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Mpv17l2; Fksg24; Mpv17-like protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-200
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Mpv17l2
Target Protein Sequence
MALGGWRWARKALAAGRPLFQGRALLLTNTLGCGVLMAAGDGARQVWEVRARPGQRFSAR RSASMFAVGCSMGPFLHFWYLWLDRLLPASGLRSLPSVMKKVLVDQTVASPILGVWYFLG LGSLEGQTLEESCQELRAKFWDFYKADWCVWPAAQLVNFLFIPSHFRVTYINGLTLGWDT YLSYLKYWVPEPLQTPGCAD
Uniprot No.

Target Background

Function
Essential for mitochondrial ribosome assembly and stability. Acts as a positive regulator of mitochondrial protein synthesis.
Database Links
Protein Families
Peroxisomal membrane protein PXMP2/4 family
Subcellular Location
Membrane; Multi-pass membrane protein. Mitochondrion inner membrane.

Q&A

What is Mpv17l2 and how does it differ from its paralog Mpv17?

Mpv17l2 is a mitochondrial protein that, despite sharing sequence similarity with Mpv17, has evolved distinct functions. While both are integral inner mitochondrial membrane proteins, Mpv17l2 is specifically involved in mitochondrial ribosome assembly and function. Unlike Mpv17 (which contributes to mtDNA maintenance), Mpv17l2 depends on the presence of mitochondrial DNA for its stability and expression . This functional divergence suggests Mpv17l2 evolved new functions after a gene duplication event, making these proteins true paralogs. The key distinction is that Mpv17 influences mtDNA maintenance directly, while Mpv17l2 affects mtDNA organization indirectly through its role in mitochondrial protein synthesis .

What is the subcellular localization pattern of Mpv17l2?

Mitochondrial fractionation analyses conclusively demonstrate that Mpv17l2 is an integral inner membrane protein of mitochondria . More specifically, when mitochondrial components are separated on iodixanol gradients, Mpv17l2 co-fractionates with mitochondrial nucleoids and ribosomal components . On sucrose gradients designed to separate ribosomal components, Mpv17l2 specifically co-sediments with the large subunit of the mitochondrial ribosome (mtLSU) and the complete monosome . This precise localization pattern is functionally significant, as it reflects Mpv17l2's role in mitochondrial ribosome assembly.

What happens to cellular function when Mpv17l2 is depleted?

Mpv17l2 depletion through RNA interference results in several significant cellular phenotypes:

  • Marked decreases in both the mitochondrial ribosomal monosome and its constituent subunits

  • Impaired protein synthesis in mitochondria

  • Mitochondrial DNA aggregation with enlarged nucleoids

  • Sequestration of small subunit mitochondrial ribosomal proteins within these enlarged nucleoids

These observations suggest a critical role for Mpv17l2 in coordinating mitochondrial ribosome assembly with nucleoid organization. Without sufficient Mpv17l2, the interactions between ribosomes and nucleoids become dysregulated, leading to compromised mitochondrial function.

What are the most effective methods for detecting Mpv17l2 in research samples?

Western blotting with specific monoclonal antibodies represents the gold standard for Mpv17l2 detection. Based on findings with the related Mpv17 protein, antibodies must be carefully validated using knockout samples to ensure specificity . For mouse Mpv17l2, researchers should note that antibodies developed against human orthologs may show reduced but specific reactivity in mouse samples.

When selecting antibodies, consider:

Antibody TypeAdvantagesLimitationsBest Applications
MonoclonalHigh specificity, consistent resultsMay recognize single epitope onlyWestern blot, IP
PolyclonalMultiple epitope recognitionBatch-to-batch variationIHC, IF

For immunoprecipitation studies, FLAG-tagged constructs of mitochondrial ribosomal proteins (such as ICT1-FLAG) can be used to co-precipitate endogenous Mpv17l2 . This approach has been successfully employed to confirm the association of Mpv17l2 with the large ribosomal subunit.

How can researchers effectively silence Mpv17l2 expression to study its function?

RNA interference (RNAi) through siRNA transfection has proven effective for Mpv17l2 gene silencing. Experimental protocols should include:

  • Appropriate controls (non-targeting siRNA)

  • Validation of knockdown efficiency through Western blotting

  • Phenotypic assessment 72-96 hours post-transfection

For studying long-term consequences of Mpv17l2 depletion, stable shRNA expression or CRISPR/Cas9 genome editing may be considered, though care must be taken as complete loss of Mpv17l2 may severely impair mitochondrial function and cell viability.

What techniques are recommended for studying Mpv17l2's role in mitochondrial ribosome assembly?

Several complementary techniques can effectively investigate Mpv17l2's role in ribosome assembly:

  • Sucrose gradient ultracentrifugation: This allows separation of mitochondrial ribosomal subunits and the monosome, enabling assessment of their relative abundance and composition following Mpv17l2 manipulation .

  • Iodixanol gradient fractionation: This technique separates mitochondrial nucleoprotein complexes, allowing researchers to examine co-fractionation of Mpv17l2 with nucleoids and ribosomal components .

  • Co-immunoprecipitation: Using antibodies against known mitochondrial ribosomal components (e.g., ICT1-FLAG for mtLSU or MRPS27-FLAG for mtSSU) can establish physical associations with Mpv17l2 .

  • Mitochondrial translation assays: Measuring incorporation of radiolabeled amino acids into newly synthesized mitochondrial proteins provides functional evidence of Mpv17l2's impact on mitochondrial protein synthesis .

How does Mpv17l2 mechanistically contribute to mitochondrial ribosome biogenesis?

Mpv17l2 appears to play a crucial role in uniting the large and small mitochondrial ribosomal subunits to form the translationally competent monosome . Several lines of evidence support this mechanism:

  • Mpv17l2 specifically co-sediments with the mtLSU and monosome in sucrose gradients

  • Mpv17l2 co-immunoprecipitates with mtLSU components but not mtSSU components

  • Mpv17l2 depletion results in marked decrease of monosome formation

  • In Mpv17l2-depleted cells, certain mtSSU proteins (e.g., MRPS27) relocate away from the normal mtSSU fraction on sucrose gradients

These findings suggest Mpv17l2 may function as an assembly factor that facilitates the joining of the two ribosomal subunits. Its integral membrane location may also help position the ribosome optimally for co-translational insertion of nascent mitochondrial proteins into the inner membrane.

What is the relationship between Mpv17l2 and mitochondrial DNA organization?

Mpv17l2 depletion induces mitochondrial DNA aggregation, suggesting a link between ribosome assembly and nucleoid organization . Experimental evidence indicates:

  • Components of the small ribosomal subunit (mtSSU) become trapped within enlarged nucleoids in Mpv17l2-depleted cells

  • Large subunit components aren't similarly affected, suggesting different dynamics between the two ribosomal subunits

  • Assembly of the mtSSU may normally occur at the nucleoid

This suggests a model where Mpv17l2 coordinates the spatial and temporal aspects of mitochondrial ribosome assembly in relation to nucleoid positioning. The enlargement of nucleoids upon Mpv17l2 depletion could represent unsuccessful attempts at mtSSU assembly that disrupt normal nucleoid structure.

How does Mpv17l2 function compare evolutionarily with its paralog Mpv17?

Despite sharing sequence similarity, Mpv17 and Mpv17l2 have evolved distinct functions in mitochondrial biology:

FeatureMpv17Mpv17l2
Subcellular locationMitochondrial inner membrane Mitochondrial inner membrane
Dependence on mtDNAIndependent of mtDNA Dependent on mtDNA (absent in ρ⁰ cells)
Primary functionmtDNA maintenance; regulates MMP-2 expression Mitochondrial ribosome assembly
Pathology when mutatedMitochondrial DNA depletion syndrome Not yet reported in clinical settings
Interaction with ribosomeDoes not co-fractionate with ribosomal subunits Co-sediments with mtLSU and monosome

This functional divergence represents a classic example of how gene duplication events can lead to evolutionary specialization of paralogs, with both proteins becoming essential for distinct aspects of mitochondrial function.

What experimental approaches can distinguish between direct and indirect effects of Mpv17l2 on mitochondrial function?

To distinguish direct from indirect effects, researchers should consider:

  • Acute vs. chronic depletion studies: Using inducible knockdown systems to observe immediate effects before secondary adaptations occur

  • Rescue experiments: Re-expressing Mpv17l2 in depleted cells to determine which phenotypes are reversible

  • Structure-function analysis: Creating targeted mutations in specific domains of Mpv17l2 to identify which regions are critical for different functions

  • Proximity labeling approaches: Using BioID or APEX2 fusions to identify proteins in direct physical proximity to Mpv17l2 within the mitochondria

  • Temporal analysis of phenotypes: Determining the sequence in which different phenotypes appear after Mpv17l2 depletion can help establish causality

What are the challenges in producing and working with recombinant Mpv17l2?

As an integral membrane protein, Mpv17l2 presents several technical challenges:

  • Expression systems: Bacterial expression often leads to inclusion body formation, requiring refolding protocols or alternative expression systems (insect cells, cell-free systems)

  • Purification challenges: Detergent selection is critical for maintaining native structure during extraction from membranes

  • Functional assessment: Since Mpv17l2 functions in the context of mitochondrial ribosomes, assessing the activity of purified protein requires reconstitution with ribosomal components

  • Structural studies: Membrane proteins are notoriously difficult for crystallography; cryo-EM approaches may be more suitable

When designing experiments with recombinant Mpv17l2, researchers should consider whether a partial construct (excluding transmembrane domains) might be sufficient for specific interaction studies.

How can researchers differentiate between the effects of Mpv17l2 on ribosome assembly versus nucleoid organization?

This remains a challenging question, as the two processes appear interconnected. Experimental approaches include:

  • High-resolution imaging: Super-resolution microscopy combined with specific markers for nucleoids (TFAM) and ribosomal subunits can visualize their spatial relationship

  • Sequential depletion and rescue: Depleting Mpv17l2 followed by rescue with mutants specifically defective in either ribosome or nucleoid interactions

  • In vitro reconstitution: Attempting to reconstitute specific aspects of ribosome assembly with purified components including Mpv17l2

  • Genetic interaction studies: Combining Mpv17l2 depletion with manipulation of known nucleoid or ribosome assembly factors to identify epistatic relationships

What are the most pressing unanswered questions regarding Mpv17l2 function?

Several key questions remain to be fully addressed:

  • The precise molecular mechanism by which Mpv17l2 facilitates the joining of mitochondrial ribosomal subunits

  • Whether Mpv17l2 has additional functions beyond ribosome assembly

  • The evolutionary history of the Mpv17 protein family and how functional specialization occurred

  • Whether Mpv17l2 mutations contribute to human disease, particularly mitochondrial translation disorders

  • The regulatory mechanisms controlling Mpv17l2 expression and activity in different physiological contexts

Researchers entering this field should consider how their experimental approaches might address these fundamental questions while building on the established knowledge of Mpv17l2's role in mitochondrial ribosome assembly.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.