Recombinant Mouse Mpv17-like protein (Mpv17l)

Shipped with Ice Packs
In Stock

Description

Functional Roles

Mpv17l modulates mitochondrial membrane potential (Δψm) and ROS metabolism via its channel activity:

  • Channel Activity: Forms a non-selective, voltage-gated channel with a pore diameter of ~1.8 nm. The channel is weakly cation-selective (PK+/PCl⁻ ~1.3) and regulated by redox conditions, pH, and phosphorylation-mimicking mutations .

  • ROS Regulation: Upregulates manganese superoxide dismutase (SOD2) mRNA levels, enhancing antioxidant defenses . Embryonic fibroblasts from Mpv17−/− mice exhibit elevated Δψm and ROS production .

  • Mitochondrial Homeostasis: Prevents excessive ROS by modulating Δψm, thereby influencing mitochondrial fission/fusion dynamics and mitophagy .

Electrophysiological Properties

  • Redox Sensitivity: Channel closure under oxidizing conditions (e.g., H₂O₂) and partial opening under reducing agents (e.g., DTT) .

  • pH Dependence: Increased open probability at acidic pH (6.0 vs. 7.4) .

  • Phosphorylation Mimetics: Mutations mimicking phosphorylation (e.g., T80D) alter gating behavior, locking the channel in a closed state .

Disease-Linked Mutations

  • p.P98L Mutation: Associated with mitochondrial DNA depletion syndrome (MDDS). This mutation disrupts channel gating, leading to incomplete closure and mitochondrial dysfunction .

  • p.D92K Mutation: Alters ion selectivity (PCa²⁺/PCl⁻ ~0.45 vs. ~0.6 in wild type), implicating Asp-92 in the selectivity filter .

In Vitro and In Vivo Models

  • Knockout Mice: Mpv17−/− mice exhibit premature aging phenotypes (e.g., gray coat, glomerulosclerosis) and elevated Δψm in embryonic fibroblasts .

  • ROS Assays: Mpv17l transfection in COS-7 cells increases SOD2 mRNA by 2.5-fold, reducing oxidative stress .

Model SystemKey Observations
Mpv17−/− Embryonic FibroblastsElevated Δψm (+25%), increased ROS (+40%), accelerated mitochondrial fission
COS-7 Cells with Mpv17lSOD2 mRNA upregulation (2.5-fold), enhanced superoxide dismutase activity

Production and Purification

Recombinant Mpv17l is typically expressed in P. pastoris or HEK293 cells, followed by:

  1. Membrane Extraction: Solubilized using Fos-choline-12 .

  2. Affinity Chromatography: His-tag purification under denaturing/native conditions .

  3. Size Exclusion Chromatography: Yields >90% pure trimeric protein .

Applications in Research

  • Mitochondrial Diseases: Modeling MDDS and neurodegenerative disorders linked to ROS imbalance .

  • Channel Biophysics: Studying voltage-gated ion transport and redox regulation in membranes .

  • Therapeutic Development: Targeting Mpv17l to restore mitochondrial function in MDDS .

Unresolved Questions

  • Mechanism of mtDNA Depletion: How Mpv17l channel activity directly impacts mtDNA copy number remains unclear .

  • Tissue-Specific Roles: Differential effects in liver, brain, and muscle require further study .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Mpv17l; Mpv17-like protein; M-LP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-194
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Mpv17l
Target Protein Sequence
MASWWRAFPQAARRYPWPTNVLLYAGLFSAGDALQQRLRGGPADWRQTRRVATLAVTFHG NFNYVWLRLLERALPGRAPRTVLAKVLCDQTVGGPIALSAFYVGMSVLQGKDDIFLDLKQ KFWNTYKSGLMYWPFVQLTNFSLVPVHWRTAYTGLCAFLWATFLCFSQQSGDGTLQSIFI FLRRKEASDKSPEK
Uniprot No.

Target Background

Function

Isoforms 1 and 3 of Mpv17-like protein are involved in reactive oxygen species metabolism, modulating the expression of antioxidant enzyme genes.

Gene References Into Functions
  1. Participation in reactive oxygen species metabolism. PMID: 12471025
  2. In mice, Mpv17l is exclusively expressed in kidneys after 6 weeks. Mpv17l transfection upregulates SOD2 and downregulates cellular glutathione peroxidase (Gpx1) and plasma glutathione peroxidase (Gpx3) gene expression. PMID: 15541722
  3. Identification of Mpv17l as a unique interacting protein and regulator of HtrA2 protease, mediating mitochondrial antioxidant and anti-apoptotic function. PMID: 18772386
Database Links
Protein Families
Peroxisomal membrane protein PXMP2/4 family
Subcellular Location
[Isoform 1]: Peroxisome membrane; Multi-pass membrane protein.; [Isoform 3]: Cytoplasm.
Tissue Specificity
Isoform 1 and isoform 3 are expressed in the kidney (at protein level). Isoform 1 is expressed in the kidney, spleen, heart, brain, lung and liver. Isoform 3 is expressed in the kidney. Isoform 1 and isoform 3 expression increase during development, reach

Q&A

What is Mouse Mpv17-like protein (Mpv17l) and how does it relate to MPV17?

Mouse Mpv17-like protein (Mpv17l) is a homologous protein to MPV17, sharing structural and functional similarities. While MPV17 is located in the inner mitochondrial membrane and is involved in mitochondrial DNA (mtDNA) maintenance, Mpv17l appears to have complementary but distinct functions. Both belong to a family of proteins with four transmembrane-spanning regions, but they differ in their tissue-specific expression patterns and precise molecular functions. MPV17 is known to be involved in reactive oxygen metabolism and has been identified as a mitochondrial inner membrane protein essential for normal mitochondrial function .

Methodologically, when studying Mpv17l, it's critical to use specific antibodies that can distinguish between MPV17 and Mpv17l proteins due to their structural similarities. Western blotting with validated antibodies against unique epitopes of each protein should be employed to confirm protein specificity in experimental systems.

What is known about the normal function of Mpv17l in mice?

Mpv17l functions in metabolic regulation, particularly in pancreatic β-cells. Knockout studies of M-LP/Mpv17L have revealed that this protein plays a role in glucose metabolism. Mice lacking Mpv17l develop pancreatic β-cell hyperplasia and exhibit improved glucose tolerance, suggesting a regulatory role in the Wnt/β-catenin signaling pathway .

To properly investigate Mpv17l function, researchers should consider both direct effects on mitochondrial function and secondary effects on cellular signaling pathways. Metabolic phenotyping including glucose tolerance tests, insulin sensitivity assays, and pancreatic islet morphometry are recommended experimental approaches when investigating Mpv17l function in vivo.

How do Mpv17l knockout models differ from MPV17 knockout models in phenotypic presentation?

The phenotypic consequences of Mpv17l knockout are distinct from those observed in MPV17 knockout models. MPV17-deficient mice develop glomerulosclerosis, hypertension, and inner ear structural alterations . In contrast, Mpv17l knockout leads to pancreatic β-cell hyperplasia and improved glucose tolerance through activation of the Wnt/β-catenin pathway .

When designing experiments to compare these models, researchers should implement comprehensive phenotyping protocols that include:

  • Renal function assessment (for MPV17 models)

  • Glucose homeostasis evaluation (for Mpv17l models)

  • Mitochondrial function analysis in tissue-specific contexts

  • Age-dependent phenotypic progression documentation

What are the most effective methods for generating recombinant Mouse Mpv17l for research purposes?

For generating recombinant Mouse Mpv17l, researchers should consider both prokaryotic and eukaryotic expression systems, with mammalian cell expression often preferred for proper post-translational modifications. Based on approaches used for MPV17, successful expression strategies include:

  • Mammalian expression systems: Similar to techniques used for MPV17, where transfection of human MPV17 in cell lines has been successful for functional studies .

  • Purification approach: Affinity tags such as His-tags can be employed, as demonstrated for MPV17 in previous studies .

  • Quality control: Verification of proper folding and membrane integration is essential, as Mpv17l is a membrane protein.

The expression vector design should incorporate appropriate signal sequences to ensure proper subcellular localization. Western blotting and immunofluorescence should be used to confirm expression levels and localization.

What experimental models are most suitable for studying Mpv17l function?

Several experimental models have proven valuable for studying MPV17-family proteins and would be applicable to Mpv17l research:

  • Cell culture models: Established cell lines with knockdown or knockout of Mpv17l, similar to the MPV17 knockdown model described in the literature that used lentiviral vector-encoded shRNA .

  • Mouse models: Knockout mice, such as the M-LP/Mpv17L-KO mice on C57BL/6 N background used in previous studies .

  • Zebrafish models: Though not specifically documented for Mpv17l, zebrafish have been successfully used for MPV17 studies using CRISPR/Cas9 system for gene knockout .

For metabolic studies, primary islet cultures from Mpv17l knockout mice could provide valuable insights into β-cell function. When selecting a model system, researchers should consider the specific pathway under investigation and the tissue-specific expression pattern of Mpv17l.

What techniques are most effective for measuring Mpv17l expression and localization?

For accurate measurement of Mpv17l expression and localization:

  • Protein quantification: Western blotting with validated antibodies, as used for MPV17 in various cell lines (HEK293T, H4, and HepG2) .

  • Subcellular localization: Immunofluorescence microscopy with co-localization markers for specific organelles.

  • mRNA expression: RT-PCR and qPCR for transcript quantification, using specific primers that distinguish between Mpv17l and MPV17.

When analyzing protein levels, particular attention should be paid to sample preparation methods for membrane proteins, including appropriate detergents for solubilization. Controls should include validation of antibody specificity using knockout or knockdown samples.

How does Mpv17l influence mitochondrial function and energy metabolism?

To investigate Mpv17l's influence on mitochondrial function, researchers should employ:

  • Respirometry analysis: Measuring oxygen consumption rates in intact cells and isolated mitochondria

  • ATP production assays: Quantifying cellular energetics

  • Mitochondrial membrane potential assessment: Using potential-sensitive dyes

  • Mitochondrial morphology evaluation: Through electron microscopy to assess cristae organization

What is the relationship between Mpv17l and the Wnt/β-catenin signaling pathway?

Mpv17l appears to be linked to the Wnt/β-catenin pathway, particularly in pancreatic β-cells. Knockout of M-LP/Mpv17L leads to improved glucose tolerance via activation of the Wnt/β-catenin pathway . This suggests Mpv17l may normally function as a negative regulator of this pathway.

To explore this relationship, researchers should:

  • Measure β-catenin nuclear translocation in Mpv17l-deficient versus wild-type cells

  • Assess expression of Wnt target genes using RT-qPCR

  • Implement TCF/LEF reporter assays to quantify pathway activation

  • Use specific Wnt/β-catenin pathway inhibitors to determine if they can reverse the phenotypes observed in Mpv17l knockout models

How does Mpv17l contribute to pancreatic β-cell function and glucose homeostasis?

Mpv17l plays a role in regulating pancreatic β-cell proliferation and function. Knockout of M-LP/Mpv17L results in pancreatic β-cell hyperplasia and improved glucose tolerance, suggesting that Mpv17l normally restricts β-cell expansion .

Experimental approaches to investigate this relationship should include:

  • Islet morphometry to quantify β-cell mass and proliferation rates

  • Glucose-stimulated insulin secretion assays in isolated islets

  • In vivo glucose tolerance tests and insulin sensitivity assessments

  • Molecular analysis of cell cycle regulators in β-cells

How might Mpv17l interact with other mitochondrial proteins to maintain organelle integrity?

Based on studies of MPV17, which interacts with proteins critical to mitochondrial cristae organization and calcium handling, Mpv17l may have similar protein interaction networks. MPV17 has been shown to interact with ATP synthase, Cyclophilin D, MIC60, and GRP75 .

To identify Mpv17l interaction partners, researchers should consider:

  • Immunoprecipitation followed by mass spectrometry: This approach successfully identified MPV17-interacting proteins

  • Proximity labeling techniques: BioID or APEX2 fusion proteins to identify proteins in close proximity to Mpv17l

  • Co-immunoprecipitation with candidate interactors: Based on known MPV17 interactors

  • Protein crosslinking: To stabilize transient interactions before extraction

What mechanisms might explain the paradoxical improvement in glucose tolerance observed in Mpv17l knockout mice?

The improved glucose tolerance in Mpv17l knockout mice presents an interesting paradox that requires mechanistic investigation. Potential explanations include:

  • Enhanced β-cell mass and function through Wnt/β-catenin activation

  • Altered mitochondrial metabolism leading to improved insulin secretion

  • Reduced oxidative stress affecting insulin signaling pathways

  • Compensatory activation of protective metabolic pathways

Research approaches should include comprehensive metabolic phenotyping, tissue-specific conditional knockout models, and detailed molecular pathway analysis including transcriptomics and metabolomics in relevant tissues.

How do post-translational modifications regulate Mpv17l function?

While specific information on Mpv17l post-translational modifications is not provided in the search results, this represents an important area for investigation. Researchers should:

  • Use mass spectrometry to identify possible phosphorylation, acetylation, or ubiquitination sites

  • Generate site-specific mutants to assess the functional importance of identified modifications

  • Investigate how metabolic states affect Mpv17l modification patterns

  • Examine how modifications might alter protein-protein interactions or subcellular localization

How can researchers address challenges in distinguishing between MPV17 and Mpv17l effects in experimental systems?

Due to the structural and functional similarities between MPV17 and Mpv17l, researchers may face challenges in experimental design and data interpretation. To address these issues:

  • Generate specific knockouts: Use CRISPR/Cas9 to create single and double knockout models to differentiate individual protein contributions

  • Employ rescue experiments: Restore expression of either protein in knockout systems to determine functional complementation

  • Use tissue-specific approaches: Focus on tissues where one protein predominates over the other

  • Develop highly specific antibodies: Validate antibodies using knockout controls to ensure specificity

What controls are essential when investigating mitochondrial function in the context of Mpv17l research?

When studying mitochondrial function in relation to Mpv17l:

  • Include appropriate wild-type controls: Always compare to proper genetic background controls

  • Control for mitochondrial content: Normalize respiratory measurements to mitochondrial mass indicators

  • Account for cellular stress responses: Include unstressed and stressed conditions (e.g., before and after ischemia/reperfusion)

  • Monitor multiple parameters: Assess membrane potential, ROS production, calcium handling, and ATP synthesis in parallel

For metabolic studies, controlling for factors such as age, sex, nutritional status, and time of day is crucial for reproducibility.

How should researchers interpret contradictory findings regarding Mpv17l function across different experimental systems?

When faced with contradictory findings:

  • Consider context-dependency: Mpv17l function may vary by tissue type, developmental stage, or metabolic state

  • Examine methodological differences: Variations in knockout strategies, expression systems, or assay conditions

  • Evaluate genetic background effects: Different mouse strains may show variable phenotypes

  • Assess compensatory mechanisms: Long-term knockouts may trigger adaptive responses that mask primary effects

Systematic literature review and meta-analysis approaches can help reconcile seemingly contradictory findings, while collaboration between research groups using different models can provide valuable cross-validation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.