Recombinant Mouse Mucolipin-2 (Mcoln2)

Shipped with Ice Packs
In Stock

Description

Viral Entry Modulation

MCOLN2 enhances infection of enveloped RNA viruses by promoting endosomal trafficking:

Virus GroupViral FamilyEnhanced by MCOLN2?
Influenza A Virus (IAV)OrthomyxoviridaeYes
Zika Virus (ZIKV)FlaviviridaeYes
Equine Arteritis Virus (EAV)ArteriviridaeYes
VEEV, RSV, VSVTogaviridae, Pneumoviridae, RhabdoviridaeNo

Mechanism:

  • Endosomal trafficking: Accelerates virus movement from early to late endosomes, enabling cytosolic escape .

  • Channel activity dependency: Mutations abolishing ion conduction (e.g., K370Q) impair viral enhancement .

Arf6 Pathway Regulation

MCOLN2 interacts with ADP-ribosylation factor 6 (Arf6) to regulate:

  • GPI-anchored protein (GPI-AP) recycling: Overexpression enhances CD59 recycling to the plasma membrane .

  • MHCI trafficking: Colocalizes with major histocompatibility complex class I molecules in vesicles .

Immune Response

MCOLN2 is induced by:

  • IFN-I/II: Upregulated in macrophages during bacterial/viral infections .

  • PAX5: B-cell transcription factor promoting MCOLN2 expression .

Functional outcomes:

  • Chemokine secretion: Knockdown impairs macrophage recruitment .

  • Autophagy regulation: Modulates autophagosome clearance, though mechanisms remain unclear .

Comparative Analysis of Recombinant MCOLN2 Products

Product CodeHostTagLengthPuritySource
RFL12255MFE. coliHisFull-length>90%
MCOLN2-5419MMammalianHis (Fc)PartialN/A
MCOLN2 Rabbit pAbN/AN/AAntibodyN/A

Critical Research Insights

  • Therapeutic potential: Targeting MCOLN2 may disrupt viral entry while sparing physiological functions .

  • Genetic variants: Rare human MCOLN2 alleles (e.g., loss-of-function) show reduced viral enhancement .

  • Methodological challenges: Functional assays require precise control of endosomal pH and ion gradients .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement in the order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All protein shipments are accompanied by standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Mcoln2; Mucolipin-2; Transient receptor potential channel mucolipin 2; TRPML2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-566
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Mcoln2
Target Protein Sequence
MPGDEETLDLPAWNRVPDLTWGPHHRSAMASLDSEVREECLREDLKFYFMSPCEKYRARR QIPWKLGLQILKIVMVTTQLVRFGLSNQLVVAFKEDNTVAFKHLFLKGFSGVDEDDYSCS IYTQENTYESIFFAIKQYRHLKNISLATLGYGESEDNRTGLKVCKQHYKTGAMFSSNETL NIDSDIETDCIHLDLQVLTTEPEDWAQTSFFRLDFYRLVQVDISFALKGIDLQAVHSREI PDCYLFQNTITFDNTAHSGKIKIYLNSEANIEECKNMNISGSTQRSTHYLLVFDVFVIMI CLASLILCTRSIVLALRLRKRFLNFFLEKYKQRVCGADQWEFVNGWYVLVTISDLMTIIG SILKMEIKAKKLTNYDVCSILLGTSTLFVWVGVIRYLGYFQTYNVLILTMQASLPKVLRF CACAGMIYLGYTFCGWIVLGPYHEKFENLNIVAECLFSLVNGDDMFATFAQIQQKSILVW LFSRLYLYSFISLFIYMVLSLFIALITDSYHTIKKYQQHGFPETDLQKFLKESGSKDGYQ KQPSALLSCLCCLRRRRSNDHLILID
Uniprot No.

Target Background

Function
Mucolipin-2 (Mcoln2) is a nonselective cation channel believed to play a role in regulating membrane trafficking events. It acts as a Ca(2+)-permeable cation channel with inwardly rectifying activity. Mcoln2 may activate ARF6 and participate in the trafficking of GPI-anchored cargo proteins to the cell surface via the ARF6-regulated recycling pathway. It may also play a role in immune processes. In adaptive immunity, TRPML2 and TRPML1 may have redundant functions in the specialized lysosomes of B cells. In the innate immune response, Mcoln2 may regulate chemokine secretion and macrophage migration. Through potential and possibly tissue-specific heteromerization with MCOLN1, it may contribute to various lysosome-dependent cellular events.
Gene References Into Functions
  1. A study reveals interesting differences in the regulation and distribution of TRPML family members and identifies a novel role for TRPML2 in the innate immune response. PMID: 26432893
  2. Mcoln2 is expressed in both B-cell lines and primary B-lymphocytes. PMID: 16137664
  3. There is a hierarchy controlling the subcellular distributions of TRPMLs such that TRPML1 and TRPML2 dictate the localization of TRPML3, and not vice versa. PMID: 16606612
  4. TRPML1 appears to play a novel role in the tissue-specific transcriptional regulation of TRPML2. PMID: 19763610
Database Links
Protein Families
Transient receptor (TC 1.A.4) family, Polycystin subfamily, MCOLN2 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Lysosome membrane; Multi-pass membrane protein. Recycling endosome membrane; Multi-pass membrane protein.
Tissue Specificity
Isoform 1 is widely expressed at very low levels. Isoform 2 is expressed at high levels in lymphoid tissues (thymus and spleen) and kidney, and at moderate levels in heart, lung, liver and stomach. Expressed in activated macrophages and microglia (at prot

Q&A

What is Mucolipin-2 (Mcoln2) and what are its alternative names?

Mucolipin-2 (Mcoln2) is an endosomal cation channel belonging to the transient receptor potential (TRP) protein superfamily. In mice, it is known by several alternative designations including Mcoln2, C86638, TRPML2, AI549968, and 3300002C04Rik. The human ortholog is designated as MCOLN2, TRPML2, or TRP-ML2. Unlike most TRP proteins that localize to the plasma membrane, Mucolipin-2 primarily resides in endosomal compartments where it functions in vesicular trafficking, membrane fusion, and immune response regulation .

What is the basic structure and function of Mucolipin-2?

Mucolipin-2, like other members of the TRP superfamily, possesses a conserved structure consisting of six transmembrane helices with cytoplasmic-oriented N- and C-terminal domains. It functions as a gated, tetrameric cation channel that permits the flow of ions across endosomal membranes. The channel requires specific aspartate residues (D463 and D464 in the selectivity pore) for proper ion conductance, as demonstrated by experiments where mutation of these residues to lysine (the MCOLN2-DD/KK mutant) abolishes channel activity and associated phenotypes . Functionally, Mucolipin-2 plays critical roles in endosomal trafficking, modulation of immune responses, and regulation of intracellular pathogen replication.

How is Mucolipin-2 regulated in immune cells?

Mucolipin-2 is an interferon-inducible protein, meaning its expression increases in response to interferon signaling during immune activation . This regulation positions Mucolipin-2 as an important component of host defense mechanisms. Studies have demonstrated that Mucolipin-2 knockout results in impaired chemokine secretion and reduced peripheral macrophage recruitment following bacterial challenge, indicating its significant role in immunity . The channel's expression and activity can be modulated in response to various immune stimuli, making it an integral component of the host cell's defense arsenal against pathogens.

What expression systems are commonly used for producing recombinant Mucolipin-2?

Recombinant Mouse Mucolipin-2 can be produced using several expression systems, each with specific advantages depending on the experimental requirements:

  • Cell-free expression systems: Provide high purity (≥85%) as determined by SDS-PAGE and are suitable for applications requiring minimal cellular contaminants .

  • Bacterial expression (E. coli): Offers cost-effective protein production for applications where post-translational modifications are less critical .

  • Yeast expression systems: Provide some eukaryotic post-translational modifications while maintaining relatively high yields .

  • Baculovirus expression systems: Suitable for producing proteins requiring insect cell-type post-translational modifications .

  • Mammalian cell expression: Optimal for studies requiring native-like post-translational modifications and proper protein folding .

The choice of expression system should be guided by the specific research application, required protein yield, and the importance of post-translational modifications to protein function.

How does Mucolipin-2 mediate viral trafficking in host cells?

Mucolipin-2 specifically enhances viral entry by promoting efficient trafficking of viruses from early to late endosomes, resulting in increased viral escape to the cytosol. This mechanism requires functional channel activity and occurs independently of antiviral signaling pathways. Research using influenza A virus (IAV) demonstrated that MCOLN2-expressing cells showed increased nuclear localization of viral nucleoprotein (NP) compared to control cells, indicating enhanced viral entry. Additionally, immunofluorescence studies revealed that more virus was present in late endosomes of MCOLN2-expressing cells at later time points (p = 0.04), suggesting that MCOLN2 either promotes more efficient trafficking to late endosomes or prevents virion degradation within these compartments .

The enhancing effect of Mucolipin-2 applies broadly to enveloped RNA viruses that require transport to late endosomes for infection, including yellow fever virus, dengue virus, Zika virus, and influenza A virus. Experiments with octadecyl rhodamine B (R18)-labeled IAV demonstrated increased fusion events in MCOLN2-expressing cells, confirming that more viral particles successfully escape from endosomes in these cells .

What role does Mucolipin-2 play in nutritional immunity against bacterial pathogens?

Mucolipin-2 functions as a critical component of nutritional immunity—the host cell's strategy to restrict pathogen growth by limiting essential nutrients. Specifically, MCOLN2 restricts Salmonella Typhi intracellular replication through magnesium deprivation. Cellular genome-wide association studies of S. Typhi intracellular replication in nearly a thousand cell lines, coupled with bacterial transcriptomics and manipulation of magnesium concentrations, demonstrated that MCOLN2 functions as a divalent cation channel that limits magnesium availability to intracellular bacteria .

Experimental evidence for this mechanism includes:

  • Knockout of MCOLN2 in THP-1 cells increased S. Typhi replication by approximately 150%

  • Salmonella strains lacking high-affinity magnesium importers (ΔmgtAΔmgtB) were killed inside wild-type THP-1 cells

  • MCOLN2 knockout provided less advantage to the magnesium importer mutant strains (60% increase) compared to wild-type S. Typhi (150% increase), confirming the magnesium deprivation hypothesis

This nutritional immunity mechanism represents an important host defense strategy against human-restricted pathogens like S. Typhi.

What techniques are most effective for studying Mucolipin-2 channel activity?

Several complementary techniques provide robust assessment of Mucolipin-2 channel activity:

  • Dominant-negative mutant approaches: Creating channel-dead mutants by substituting key residues in the selectivity pore (e.g., MCOLN2-DD/KK where D463 and D464 are mutated to lysine) allows researchers to distinguish between channel-dependent and channel-independent functions .

  • Electrophysiological recordings: Patch-clamp techniques can directly measure ion conductance through Mucolipin-2 channels, though this requires specialized equipment and expertise.

  • Fluorescent ion indicators: Genetically encoded or chemical fluorescent sensors for specific ions (Ca²⁺, Na⁺, etc.) can be used to monitor ion flux in living cells with Mucolipin-2 expression or knockout.

  • Endosomal pH measurements: Since Mucolipin-2 activity can affect endosomal pH, measuring changes using pH-sensitive fluorescent dyes or proteins can indirectly assess channel function.

  • Real-time trafficking assays: Using fluorescently labeled cargo (e.g., R18-labeled viruses) to track movement through endosomal compartments in Mucolipin-2 wild-type versus knockout or overexpressing cells .

How can researchers effectively generate and validate Mucolipin-2 knockout models?

Generating reliable Mucolipin-2 knockout models requires careful design and comprehensive validation:

Generation approaches:

  • CRISPR/Cas9-mediated knockout: Target early exons (e.g., exon 3) to maximize disruption. For example, researchers have successfully used the guide RNA sequence 5'-TTTTGGTTTAAGTAACCAGC-3' (with PAM sequence TGG) to target Mucolipin-2 exon 3 .

  • Conditional knockout systems: For studying tissue-specific or temporal effects, consider Cre-loxP or tetracycline-inducible systems.

Validation requirements:

  • Genomic verification: Confirm indel formation using Sanger sequencing and analysis with tools like Inference of CRISPR Editing (ICE) to assess frameshift frequency (aim for ≥85% frameshift) .

  • Transcript verification: Use RT-PCR to confirm absence or significant reduction of Mucolipin-2 mRNA.

  • Protein verification: Western blotting with specific antibodies to confirm complete protein loss.

  • Functional validation: Test known phenotypes (e.g., altered viral trafficking or bacterial replication) to confirm functional knockout.

  • Off-target effect assessment: Sequence potential off-target sites identified by guide RNA design software to rule out unintended modifications.

Thorough validation is critical as incomplete knockout or off-target effects can lead to misinterpretation of experimental results.

What is known about Mucolipin-2's role in cancer progression?

Emerging evidence suggests that Mucolipin-2 may play a significant role in cancer biology, particularly in prostate cancer (PCa). Studies have demonstrated that MCOLN2 expression is significantly elevated in PCa tissues compared to normal tissues, and this elevated expression is associated with poor prognosis. Functionally, MCOLN2 has been shown to promote migration and invasion of PCa cells, suggesting a potential role in metastasis .

The mechanistic basis for MCOLN2's oncogenic effects likely involves its endolysosomal functions, which may alter cellular trafficking, signaling pathway activation, or metabolic processes that support cancer cell survival and dissemination. Given that bone is a preferential site for PCa metastasis, the role of MCOLN2 in this process represents an important area for further investigation .

This emerging connection between an endolysosomal ion channel and cancer progression highlights the potential for targeting MCOLN2 in therapeutic approaches and warrants further research into its role in other cancer types.

How does human genetic variation in MCOLN2 impact susceptibility to infectious diseases?

Human genetic diversity in MCOLN2 has significant implications for host-pathogen interactions. Research has identified rare genetic variants of MCOLN2 that exhibit a loss-of-function phenotype with respect to viral enhancement, suggesting that natural variation in this gene may influence susceptibility to viral infections .

Additionally, genome-wide association studies (GWAS) of cellular traits have revealed that MCOLN2 genetic variation impacts susceptibility to human-restricted pathogens like Salmonella Typhi. This variation appears to affect the channel's ability to restrict magnesium availability to intracellular bacteria, representing natural diversity in nutritional immunity mechanisms .

The identification of these variants provides valuable insights into potential genetic determinants of infection outcomes and highlights MCOLN2 as an important mediator of host-pathogen interactions. Understanding these genetic factors could inform personalized approaches to infectious disease treatment and prevention strategies.

What are the optimal conditions for studying Mucolipin-2 function in vitro?

When designing experiments to study Mucolipin-2 function in vitro, researchers should consider the following parameters:

Cell System Selection:

  • Human cell lines (e.g., U-2 OS, A549, THP-1) have been successfully used for MCOLN2 studies

  • For mouse Mcoln2, consider RAW264.7 macrophages or primary bone marrow-derived macrophages

  • Match cell type to the specific function being studied (e.g., immune cells for pathogen interactions)

Expression Systems:

  • For overexpression: Ensure moderate expression levels to prevent artifacts from excessive overexpression

  • For knockout: Validate complete loss of protein expression and function

  • Consider inducible systems to study acute versus chronic effects

Assay Conditions:

  • Ensure appropriate endosomal pH (typically 5.0-6.0 for late endosomes)

  • Control for divalent cation concentrations, particularly Mg²⁺ (≤10μM concentration to mimic Salmonella-containing vacuole)

  • Include channel-dead mutants (MCOLN2-DD/KK) as critical controls

Time Course Considerations:

  • For trafficking studies, include multiple time points (e.g., 1-3 hours for viral trafficking)

  • For bacterial replication, extend to 24-48 hours to capture full replication cycle

Optimizing these conditions will enhance reproducibility and physiological relevance of Mucolipin-2 functional studies.

What are the key technical challenges in producing high-quality recombinant Mucolipin-2?

Producing high-quality recombinant Mucolipin-2 presents several technical challenges that researchers should address:

Membrane Protein Solubility:

  • As a six-transmembrane domain protein, Mucolipin-2 has hydrophobic regions that can cause aggregation

  • Solution: Use appropriate detergents (e.g., n-dodecyl-β-D-maltoside) or lipid nanodiscs for solubilization

Preserving Channel Structure:

  • Maintaining the tetrameric assembly and proper folding is critical for functional studies

  • Solution: Consider mild purification conditions and avoid harsh denaturants

Post-translational Modifications:

  • Native glycosylation and other modifications may be important for function

  • Solution: Use mammalian or insect cell expression systems when modifications are critical

Purity Requirements:

  • Standard preparations achieve ≥85% purity by SDS-PAGE

  • Solution: Consider additional purification steps (e.g., size exclusion chromatography) for applications requiring higher purity

Functional Validation:

  • Verifying that recombinant protein retains ion channel activity

  • Solution: Incorporate into proteoliposomes or nanodiscs for electrophysiological measurements

Addressing these challenges requires careful selection of expression systems and purification strategies based on the specific experimental requirements.

How can researchers effectively differentiate between the functions of Mucolipin-2 and other Mucolipin family members?

The Mucolipin family includes three members (MCOLN1-3) with partially overlapping functions, making it challenging to isolate Mucolipin-2-specific effects. Effective differentiation strategies include:

Genetic Approaches:

  • Single vs. Multiple Knockouts: Compare phenotypes of Mcoln2-specific knockout with Mcoln1 or Mcoln3 knockouts and combination knockouts

  • Rescue Experiments: Attempt rescue of knockout phenotypes with each family member to test functional redundancy

  • Domain Swapping: Create chimeric proteins to identify domains responsible for unique functions

Expression Analysis:

  • Tissue/Cell-Type Specificity: Leverage differences in expression patterns (e.g., MCOLN2 is more highly expressed in immune cells)

  • Regulation Differences: MCOLN2 is interferon-inducible, while MCOLN1 and MCOLN3 have different regulatory mechanisms

Functional Readouts:

  • Viral Enhancement: MCOLN2 and MCOLN3, but not MCOLN1, enhance IAV infection when ectopically expressed

  • Calcium Signaling: Each family member has distinct calcium conductance properties that can be measured

  • Subcellular Localization: While all localize to endosomes, subtle differences in precise compartment targeting exist

Pharmacological Approaches:

  • Selective Modulators: Where available, use compounds with selectivity for specific family members

  • pH Sensitivity: Exploit differences in pH sensitivity among family members

These complementary approaches provide a robust framework for dissecting the specific contributions of Mucolipin-2 to cellular processes.

What are common pitfalls in Mucolipin-2 research and how can they be addressed?

Researchers studying Mucolipin-2 often encounter several challenges that can impact experimental outcomes. Here are common pitfalls and their solutions:

Expression Level Variability:

  • Problem: Inconsistent expression levels between experiments leading to variable phenotypes

  • Solution: Establish stable cell lines with validated expression levels; use inducible systems with titrated inducer concentrations

Functional Redundancy:

  • Problem: Other Mucolipin family members (MCOLN1, MCOLN3) mask Mcoln2-specific effects

  • Solution: Use double or triple knockouts; conduct experiments in cell types with minimal expression of other family members

Antibody Specificity:

  • Problem: Cross-reactivity with other Mucolipin family members due to sequence similarity

  • Solution: Validate antibodies using knockout controls; consider epitope-tagged versions for detection

Channel Activity Assessment:

  • Problem: Difficulty in confirming that observed phenotypes depend on ion channel function

  • Solution: Always include channel-dead mutants (MCOLN2-DD/KK) as controls

Subcellular Localization:

  • Problem: Overexpression can cause mislocalization to non-native compartments

  • Solution: Use moderate expression levels; confirm localization of endogenous protein

Pathogen-Based Assays:

  • Problem: High variability in infection assays due to multiple factors

  • Solution: Standardize MOI, infection time, and cell density; use reporter viruses or bacteria when possible

Addressing these pitfalls through careful experimental design will enhance the reliability and reproducibility of Mucolipin-2 research findings.

How can researchers resolve contradictory findings in Mucolipin-2 function across different studies?

When confronted with seemingly contradictory findings about Mucolipin-2 function, researchers should systematically evaluate several factors that might explain the discrepancies:

Contextual Differences:

  • Cell Type Variation: Mucolipin-2 may function differently in different cell types. For example, its role in viral enhancement has been demonstrated in U-2 OS and A549 cells , while its restriction of bacterial replication was shown in THP-1 cells .

  • Species Differences: Mouse Mcoln2 and human MCOLN2 may have subtle functional differences despite high sequence similarity.

  • Pathogen-Specific Effects: Mucolipin-2 enhances viral infection but restricts bacterial replication , representing context-dependent functions rather than contradictions.

Methodological Factors:

  • Expression Levels: Overexpression versus endogenous studies may yield different results due to dosage effects.

  • Knockout Strategies: Different targeting approaches may lead to varying levels of protein depletion.

  • Assay Sensitivity: Different readouts (e.g., microscopy versus flow cytometry) have different detection thresholds.

Resolution Strategies:

  • Direct Replication: Attempt to directly replicate contradictory studies using identical methods.

  • Combined Approaches: Apply multiple complementary techniques to study the same process.

  • Collaboration: Engage with authors of contradictory studies to identify subtle methodological differences.

  • Unified Model Development: Develop models that accommodate seemingly contradictory findings by considering Mucolipin-2's multiple functions in different contexts.

By systematically addressing these factors, researchers can reconcile apparent contradictions and develop a more nuanced understanding of Mucolipin-2's multifaceted functions.

What emerging technologies could advance our understanding of Mucolipin-2 function?

Several cutting-edge technologies hold promise for deeper insights into Mucolipin-2 biology:

Cryo-Electron Microscopy:

  • High-resolution structural determination of Mucolilin-2 in different conformational states would provide mechanistic insights into channel gating and ion selectivity

  • Structural information could guide rational design of specific modulators

Advanced Live Cell Imaging:

  • Super-resolution microscopy techniques (STORM, PALM) could reveal precise subcellular localization and dynamics

  • Correlative light and electron microscopy (CLEM) would connect Mucolipin-2 localization to ultrastructural features

Organoid and Tissue-Specific Models:

  • Intestinal organoids for studying Mucolipin-2 in enteric pathogen infections

  • Immune cell-specific conditional knockout mice to examine tissue-specific functions

Single-Cell Approaches:

  • Single-cell RNA-seq to identify cell populations with differential Mucolipin-2 expression or response

  • Single-cell proteomics to detect post-translational modifications and interaction partners

CRISPR Screening Innovations:

  • CRISPRa/CRISPRi libraries to identify regulators of Mucolipin-2 expression

  • Base editing for introducing specific mutations to study structure-function relationships

AI-Based Protein Function Prediction:

  • Machine learning approaches to predict interaction partners and functional domains

  • Molecular dynamics simulations to model ion flow and gating mechanisms

These emerging technologies, when applied to Mucolipin-2 research, could resolve longstanding questions and reveal unexpected functions of this multifaceted channel protein.

What are promising research areas for therapeutic targeting of Mucolipin-2?

Given Mucolipin-2's diverse biological functions, several therapeutic applications warrant investigation:

Infectious Disease Applications:

  • Viral Infection Inhibition: Since MCOLN2 enhances infection of multiple viruses including influenza and flaviviruses , selective inhibitors could potentially serve as broad-spectrum antiviral agents.

  • Bacterial Infection Enhancement: Conversely, temporary MCOLN2 inhibition might increase magnesium availability to intracellular pathogens like Salmonella Typhi, potentially making them more susceptible to antibiotics that require active bacterial replication .

Cancer Therapeutics:

  • Metastasis Prevention: Given MCOLN2's role in promoting migration and invasion of prostate cancer cells , inhibitors might reduce metastatic potential.

  • Biomarker Development: Elevated MCOLN2 expression correlates with poor prognosis in prostate cancer , suggesting potential as a prognostic biomarker.

Immunomodulation:

  • Macrophage Function: Targeting MCOLN2 could potentially modulate macrophage activation, chemokine secretion, and recruitment in inflammatory conditions.

  • Interferon Response: As an interferon-inducible gene , MCOLN2 represents a potential target for fine-tuning interferon responses in autoimmune diseases.

Drug Development Considerations:

  • Channel-Specific Modulators: Design compounds that specifically target MCOLN2 without affecting other TRP channels.

  • Tissue-Targeted Delivery: Develop strategies to target MCOLN2 modulators to specific tissues (e.g., prostate) to minimize systemic effects.

  • Conditional Regulation: Explore approaches to modulate MCOLN2 function in specific cellular compartments or under certain conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.