Recombinant Mouse Muscarinic acetylcholine receptor M1 (Chrm1)

Shipped with Ice Packs
In Stock

Description

Neurodegenerative Disease Studies

  • Prion Disease Models: Recombinant Chrm1 has been used to study neuroprotection in prion-diseased mice. Biased M1 receptor mutants (M1-PD) lacking phosphorylation sites showed accelerated neurodegeneration, while wild-type receptors delayed disease progression by reducing neuroinflammation and biomarkers like GFAP and APO-E .

  • Mitochondrial Dysfunction: Chrm1 knockout mice exhibited reduced cortical mitochondrial respiration (35% decrease in basal oxygen consumption) and disrupted ATP synthase oligomerization, linking M1 receptors to metabolic regulation .

Cognitive and Behavioral Insights

  • Memory Modulation: M1 receptor activation enhances MAPK signaling in hippocampal neurons, critical for synaptic plasticity .

  • Disease Biomarkers: Single nucleotide polymorphism c.267C>A in CHRM1 correlates with reduced grey matter volume in schizophrenia patients .

Therapeutic Implications

  • Alzheimer’s Disease: M1-selective positive allosteric modulators (PAMs) restore cognition and reduce amyloid-β plaques in preclinical models .

  • Drug Design: Biased agonists promoting phosphorylation/arrestin signaling (e.g., M1-PD mutants) minimize adverse effects while maintaining neuroprotection .

Key Research Studies

Study FocusFindingsCitation
Prion Disease ProgressionM1-PD mice showed 20% shorter lifespan vs. wild-type in prion models
Mitochondrial RespirationChrm1⁻/⁻ mice: 45% reduction in cortical ATP synthase activity
Receptor SignalingArrestin-biased M1 variants reduce ERK1/2 overactivation (P < 0.0001)

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your request accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Chrm1; Chrm-1; Muscarinic acetylcholine receptor M1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-460
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MNTSVPPAVSPNITVLAPGKGPWQVAFIGSTTGLLSLATVTGNLLVLISIKVNTELKTVN NYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLIS FDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYI QFLSQPIITFGTAMAAFYLPVTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSS SERSQPGAEGSPESPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEV VIKMPMVDPEAQAPTKQPPKSSPNTVKRPTKKGRDRGGKGQKPRGKEQLAKRKTFSLVKE KKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTVNPMCYAS CNKAFRDHFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC
Uniprot No.

Target Background

Function
The muscarinic acetylcholine receptor mediates diverse cellular responses, including inhibition of adenylate cyclase, phosphoinositide breakdown, and modulation of potassium channels through the action of G proteins. The primary transducing effect is Pi turnover.
Gene References Into Functions
  1. Research suggests that direct inhibition of acetylcholinesterase activity and up-regulation of m1 muscarinic acetylcholine receptor expression in the striatum might contribute to the beneficial effects of alpha-asarone on locomotor hyperactivity in Fmr1 knockout mice. PMID: 27316341
  2. The three receptor sets examined (mAChR, AR, and TrkB receptors) play a role in modulating the conditions of competition between nerve endings. PMID: 27339059
  3. Memory deficits observed in mouse prion disease were completely restored by treatment with benzyl quinolone carboxylic acid (BQCA) and benzoquinazoline-12 (BQZ-12), two highly selective positive allosteric modulators (PAMs) of M1 mAChRs. Notably, prolonged exposure to BQCA significantly extended the lifespan of diseased mice. PMID: 27991860
  4. Data suggests that the inositol phosphate accumulation assay is a valuable tool for evaluating M1 muscarinic acetylcholine receptor activators in vivo. PMID: 27958713
  5. Determining the phosphorylation status of the M1 mAChR at Ser(228) not only provides a method for establishing receptor activation following drug treatment both in vitro and in vivo but also enables mapping of the activation status of the M1 mAChR in the hippocampus. PMID: 26826123
  6. This study revealed that M1 receptor knockout mice exhibit higher noradrenaline levels compared to wildtype mice, accompanied by a decrease in IgG-producing B cells. PMID: 26002586
  7. M1 Muscarinic Receptor Deficiency Attenuates Azoxymethane-Induced Chronic Liver Injury in Mice PMID: 26374068
  8. Elevated M1 muscarinic receptor expression is associated with acute liver injury. PMID: 25452146
  9. This study demonstrated that Expression of m1-type muscarinic acetylcholine receptors by parvalbumin-immunoreactive neurons in the primary visual cortex. PMID: 23983014
  10. The mm (chi(1) congruent with -60 degrees ; chi(2) congruent with -60 degrees ) and tp (chi(1) congruent with 180 degrees ; chi(2) congruent with +60 degrees ) rotamers were identified as the likely conduction-catalyzing conformations of the AChR's selectivity-filter glutamates. PMID: 25049389
  11. While the M3 receptor has a pro-inflammatory role in cigarette smoke-induced neutrophilia and cytokine release, M1 and M2 receptors exhibit an anti-inflammatory role. PMID: 23397297
  12. The findings of this study suggested that M1-muscarinic receptors promote fear memory consolidation via phospholipase C and the M-current. PMID: 24478341
  13. mAChRs in mouse colonic epithelial cells comprise two subtypes, M1 (80%) and M3 (20%). The M1 subtype appears to negatively regulate epithelial chloride secretion and is susceptible to inflammation. PMID: 23242454
  14. M1 receptor co-localizes with VGLUT2 on the intraganglionic laminar endings of the esophagus. PMID: 23742744
  15. Downregulation of the M1 muscarinic receptor in klotho mutant mice and inactivation of the JAK2/STAT3 signaling axis play a crucial role in cognitive impairment. PMID: 23389690
  16. In the prefrontal cortex, the M1 receptor enhances cyclic AMP formation and signaling to the nucleus. PMID: 22456324
  17. Structural rearrangement analysis using FRET revealed that Gq coupling stabilizes the active conformation of the muscarinic M1 receptor. PMID: 23085334
  18. M1-mAChRs function at both surface and intracellular sites in telencephalon neurons, including the hippocampus. PMID: 23678982
  19. A low concentration of N-methyl-d-aspartate induces long-lasting hippocampal cell damage, and endogenous acetylcholine plays a protective role in the excitotoxicity-induced long-lasting hippocampal cell damage via the muscarinic M(1) receptor. PMID: 23220711
  20. These data suggest that M1R(-/-) mice exhibit abnormal responding despite relatively preserved attention, learning, and perception. PMID: 21903112
  21. Data indicate that CFP/YFP-M(1) mAChR chimera is predominantly expressed at the plasma membrane. PMID: 22272263
  22. Disrupting the M(1)R contributes to the exacerbation of Alzheimer's disease-related cognitive decline and pathological features. PMID: 21704011
  23. The P2X7R-Panx1 complex may serve as an important negative modulator of M1 receptor-mediated seizure activity in vivo. PMID: 21505260
  24. Our findings conclude that M1 and M4 receptors are the primary mAChR subtypes responsible for direct cholinergic modulation of the excitatory hippocampal circuit. PMID: 21160001
  25. The gating rate and equilibrium constants for receptors with point mutations of alpha-subunit residues located between the binding sites and the membrane domain. PMID: 20682257
  26. The results of this study indicated that the M1 mAChR is a significant regulator of amyloidogenesis in the brain and provide strong support for targeting the M1 mAChR as a therapeutic candidate in Alzheimer's disease. PMID: 20335454
  27. The muscarinic M1 receptor is strategically positioned in the cortex to sense ambient ACh released from cholinergic terminals at varying distances and to enhance the synaptic efficacy and excitability of pyramidal cells. PMID: 20335477
  28. Our data provide important insights into the molecular basis of gamma oscillations by definitively establishing a novel role for muscarinic modulation of I(h) and I(cat) in rhythmic network activity. PMID: 11856534
  29. Activation on sympathetic postganglionic cells results in catecholamine-mediated cardiac stimulation. PMID: 11907166
  30. Only 15% of the M1 receptors in the mouse hippocampus were required for maximal binding of oxotremorine-M-stimulated GTP-gamma-35S, suggesting that the M1 receptor is the primary G(alpha)(q)/11-coupled muscarinic receptor in the mouse cerebrum. PMID: 12106668
  31. Muscarinic receptors are the predominant receptors mediating contractile responses in female mouse urinary bladder smooth muscle, with strain differences. PMID: 12359634
  32. The presence of muscarinic M1 receptor-mediated relaxation in the stomach fundus supports the neuronal localization of a muscarinic M1 receptor that activates nitric oxide release to effect relaxation. PMID: 12538821
  33. M1 mAChRs modulate neurotransmitter signaling in the cortex and hippocampus. Review. PMID: 12675128
  34. Muscarinic M1 receptors activate phosphoinositide hydrolysis in the cortex and hippocampus of mice, consistent with the role of M1 receptors in cognition. Muscarinic M1 receptors appear to be the only muscarinic receptor subtype mediating seizures. PMID: 12713643
  35. RGS2 binds directly to the third intracellular (i3) loop of the G(q/11)-coupled M1 muscarinic cholinergic receptor (M1 mAChR; M1i3). PMID: 14976183
  36. M1 muscarinic receptors selectively modulate CaV1.3 in striatal medium spiny neurons. PMID: 15689540
  37. In gastric chief cells, a combination of M1 and M3 receptors mediates cholinergic stimulation of pepsinogen secretion, and no other muscarinic receptor subtypes are involved in this activity. PMID: 15933222
  38. KCNQ channel currents in striatal medium spiny neurons were potently reduced by M1 muscarinic receptors. PMID: 16093396
  39. Agrin and perlecan cluster with laminin-2 to contribute to the assembly of aneural AChR clusters that precede neural agrin release, as well as affect later NMJ development. PMID: 16219760
  40. Physiologically released acetylcholine from cholinergic fibers modulates hippocampal synaptic plasticity through the postsynaptic M1 mAChR activation. PMID: 16319319
  41. The afterdepolarization in stratum oriens-lacunosum moleculare cells, mediated by M1/M3 receptors, was associated with inhibition of an M current, a slow calcium-activated potassium current, and a calcium-dependent non-selective cationic current. PMID: 16322052
  42. Data show that cocaine-induced status epilepticus and lethality produce differential changes in brain muscarinic M(1) and dopaminergic D1 and 2 receptors, depending on the brain area studied. PMID: 16633898
  43. Can trigger glandular secretions. PMID: 17192665
  44. Results suggest that M1 and M5 muscarinic cholinergic receptors are not involved in anti-viral immunity. PMID: 17286988
  45. The decreased pituitary-adrenal sensitivity to oxotremorine and restraint stress noted in M(1) knockout mice is consistent with M(1) being primarily a postsynaptic receptor. PMID: 18363805
  46. The decrease in ACh-induced relaxation following perinatal hypoxia suggests that M(1)AChR-mediated alteration of ACh-induced relaxation is due to the activation of calcium-dependent PDE1. PMID: 18469116
  47. It is concluded that M1 muscarinic receptors may play a time-dependent role in the consolidation of reward-related memory of morphine. PMID: 18502314
  48. Results demonstrate that M1 receptors facilitate cue detection behaviors and are both necessary and sufficient for most direct effects of ACh on pyramidal neuron excitability. PMID: 19657040
  49. Dysfunction of mAChRs might be a substantial basis for the progressive neurological deterioration in mice with a double knockout of GD2 and GD3 synthase. PMID: 19744524

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor 1 family, Muscarinic acetylcholine receptor subfamily, CHRM1 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein.

Q&A

What are the primary signaling pathways associated with the mouse M1 muscarinic acetylcholine receptor?

The mouse M1 muscarinic acetylcholine receptor predominantly couples to G proteins of class Gq/G11, initiating signaling through upregulation of phospholipase C, which leads to increased inositol trisphosphate and intracellular calcium mobilization. While this is the primary pathway, M1 receptors also demonstrate coupling to Gi (causing downstream decrease in cAMP) and Gs (causing increased cAMP) in specific tissue contexts. This versatility in G protein coupling contributes to the receptor's diverse physiological functions . The receptor is preassembled to the Gq heterotrimer through a polybasic C-terminal domain, which facilitates efficient signal transduction upon agonist binding .

How does the distribution of M1 muscarinic receptors in mouse brain correlate with their functional roles?

M1 muscarinic receptors are predominantly expressed in higher brain regions associated with cognitive processes, including the hippocampus and cerebral cortex . This distribution pattern directly correlates with the receptor's functional involvement in learning, memory, and cognitive flexibility . The high receptor density in the hippocampus, particularly in CA1 pyramidal neurons, underlies its critical role in synaptic plasticity and memory consolidation . Cortical expression patterns support its involvement in attention, perception, and executive functions such as task switching . Studies with M1 receptor knockout mice have demonstrated that these anatomical distributions are functionally significant, as targeted receptor deletion results in specific cognitive deficits without major morphological abnormalities .

What are the key considerations when using M1 receptor knockout (Chrm1 tm1Jwe) mice in experimental design?

The experimental design should account for specific phenotypic characteristics: these mice exhibit deficits in cortical memory functions that require cerebral cortex-hippocampus interactions, but may show normal performance in other cognitive domains . When studying signaling pathways, note that muscarinic agonist-induced activation of the MAPK pathway is virtually abolished in cortical cultures or CA1 hippocampal neurons from these mice, providing a useful readout for M1 receptor function .

For immunohistochemical or binding studies, researchers should be aware that commercially available antibodies may exhibit cross-reactivity with other muscarinic receptor subtypes, necessitating careful validation through comparison with knockout tissue controls.

What methodologies are most effective for assessing M1 receptor signaling efficiency in recombinant systems versus native tissue preparations?

For assessing M1 receptor signaling efficiency, researchers must select methodologies based on the specific research questions and experimental context:

In recombinant systems:

  • [35S]-GTPγS binding assays coupled with Gαq/11 immunocapture provide direct measurement of receptor-G protein coupling efficiency, allowing calculation of both potency (EC50) and efficacy parameters .

  • BRET or FRET-based approaches offer real-time monitoring of receptor conformational changes and protein-protein interactions.

  • Calcium mobilization assays using fluorescent indicators (Fura-2, Fluo-4) are effective for measuring downstream signaling but may not distinguish between direct and indirect effects.

In native tissue preparations:

  • The [35S]-GTPγS-Gαq/11 immunocapture method has been successfully applied to post-mortem human brain tissue and can be adapted for mouse brain preparations to measure agonist potency and efficacy .

  • Electrophysiological recordings can assess M1 receptor-mediated changes in neuronal excitability and synaptic transmission.

  • Phospho-specific antibodies against receptor phosphorylation sites or downstream effectors (ERK1/2, CREB) can track signaling cascade activation.

Comparative analysis between recombinant and native systems should account for differences in receptor expression levels, the presence of regulatory proteins, and potential compensatory mechanisms in knockout models .

How does altered M1 receptor phosphorylation status contribute to neurodegenerative disease progression?

M1 receptor phosphorylation status plays a crucial role in neurodegenerative disease progression through multiple mechanisms. Research using G protein-biased M1-receptor mouse models has demonstrated that the receptor's phosphorylation state directly affects its neuroprotective capacity . When the M1 receptor maintains appropriate phosphorylation, it enhances neuroprotective signaling pathways while minimizing potentially harmful signaling cascades .

Specifically, phosphorylation of the M1 receptor influences:

  • Amyloid precursor protein (APP) processing: Properly phosphorylated M1 receptors regulate proteolytic processing of APP, potentially reducing amyloid beta generation and accumulation .

  • Signal transduction bias: Phosphorylation directs signaling toward specific pathways that promote neuronal survival and synaptic integrity over pathways that may exacerbate neurodegeneration .

  • Receptor desensitization kinetics: Altered phosphorylation affects receptor internalization and recycling rates, potentially disrupting cholinergic signaling homeostasis in affected brain regions .

This research suggests that therapeutic approaches targeting the M1 receptor should specifically consider compounds that maintain appropriate receptor phosphorylation status, as these will be more likely to exert beneficial neuroprotective effects in neurodegenerative conditions such as Alzheimer's disease .

What evidence supports targeting mouse M1 receptors for cognitive enhancement in models of neurological disorders?

Substantial evidence supports targeting mouse M1 receptors for cognitive enhancement in neurological disorder models:

First, genetic studies with M1 receptor knockout mice demonstrate that these receptors are critically involved in cortical memory functions requiring cerebral cortex-hippocampus interactions . The muscarinic agonist-induced activation of the MAPK pathway, essential for synaptic plasticity and cognitive functions, is virtually abolished in primary cortical cultures or CA1 hippocampal neurons from M1R knockout mice .

Second, pharmacological studies have shown that M1-receptor-selective positive allosteric modulators (PAMs) improve cognition in preclinical animal models . The orthosteric agonists xanomeline and GSK-5, which primarily activate M1 receptors, have demonstrated promising efficacy in both preclinical models and early clinical trials .

Third, mechanistic studies reveal that M1 receptors mediate core aspects of cognition including perception, attention, and memory consolidation . They contribute to cognitive flexibility, synaptic plasticity modulation, and working memory—all functions compromised in neurological disorders .

How do different phosphorylation patterns of the M1 receptor influence G protein versus arrestin-dependent signaling?

Different phosphorylation patterns of the M1 receptor create a complex signaling barcode that differentially regulates G protein versus arrestin-dependent pathways. Research with genetically engineered mouse models expressing G protein-biased M1 receptors has revealed critical insights into these mechanisms .

When the M1 receptor is phosphorylated at specific serine/threonine residues in the third intracellular loop and C-terminal tail, it promotes β-arrestin recruitment, leading to:

  • Receptor internalization and trafficking

  • Activation of arrestin-dependent signaling cascades (e.g., MAPK pathways via scaffolding functions)

  • Desensitization of G protein-dependent signaling

In contrast, receptors with reduced phosphorylation at these sites show:

  • Enhanced and prolonged coupling to Gq/11 proteins

  • Increased calcium mobilization and PKC activation

  • Reduced arrestin recruitment and internalization

  • Limited activation of arrestin-dependent signaling

This phosphorylation-dependent signaling bias has significant implications for drug development. M1 receptor ligands that maintain appropriate receptor phosphorylation can potentially preserve neuroprotective signaling while minimizing adverse effects associated with excessive activation of certain pathways . This principle has been demonstrated in mouse models of neurodegenerative disease, where maintaining M1 receptor phosphorylation status correlated with enhanced neuroprotective outcomes .

What are the molecular mechanisms by which M1 receptor activation modulates synaptic plasticity in hippocampal neurons?

M1 receptor activation modulates synaptic plasticity in hippocampal neurons through several interconnected molecular mechanisms:

  • Modulation of ion channels: M1 receptor activation reduces K+ conductance through KCNQ channels, increasing neuronal excitability and lowering the threshold for long-term potentiation (LTP) induction .

  • MAPK pathway activation: M1 receptors couple to the MAPK pathway in CA1 hippocampal neurons, facilitating phosphorylation of CREB and subsequent gene expression changes necessary for long-term memory formation. Studies in M1R knockout mice demonstrate that this pathway is virtually abolished without functional M1 receptors .

  • Regulation of NMDA receptor function: M1 receptor stimulation enhances NMDA receptor currents through PKC-dependent phosphorylation, promoting calcium influx required for synaptic plasticity.

  • Protein synthesis modulation: M1 receptor-mediated signaling activates the mammalian target of rapamycin (mTOR) pathway, regulating local protein synthesis necessary for synapse remodeling and memory consolidation.

  • Acetylcholinesterase inhibition effects: While not a direct effect of receptor activation, increased acetylcholine levels due to cholinesterase inhibition enhances M1 receptor activation, potentiating glutamatergic transmission at CA3-CA1 synapses.

This multifaceted influence on synaptic plasticity underlies the critical role of M1 receptors in learning and memory processes, explaining why M1 receptor modulation is a target for cognitive enhancement strategies in neurodegenerative conditions .

What are the comparative efficacies of orthosteric versus allosteric modulators of M1 receptors in preclinical models?

Orthosteric and allosteric modulators of M1 receptors demonstrate distinct efficacy profiles in preclinical models, each with specific advantages and limitations:

Orthosteric Agonists:

  • Compounds like xanomeline and GSK-5 have shown promising efficacy in improving cognition in preclinical models and early clinical trials .

  • They typically exhibit high potency at M1 receptors but often lack complete selectivity due to the highly conserved orthosteric binding site across muscarinic receptor subtypes.

  • This lack of selectivity frequently leads to off-target activation of M2 and M3 receptors, contributing to cholinergic adverse effects that have limited clinical development .

Positive Allosteric Modulators (PAMs):

  • PAMs like benzylquinolone carboxylic acid, VU-0090157, and VU0467319 offer greater subtype selectivity by binding to less conserved allosteric sites .

  • They enhance the effect of endogenous acetylcholine without directly activating the receptor in its absence, potentially reducing adverse effects.

  • PAMs have demonstrated improved cognition in preclinical models while producing fewer cholinergic side effects compared to orthosteric agonists .

Biased Ligands:

  • Emerging research with G protein-biased M1 receptor mouse models suggests that ligands maintaining receptor phosphorylation/arrestin-dependent signaling can minimize adverse responses while preserving cognitive enhancement and neuroprotective effects .

  • This represents a promising new direction for therapeutic development that may overcome the limitations of both traditional orthosteric agonists and first-generation PAMs.

For researchers developing M1 receptor-targeted therapies, these comparative efficacy profiles suggest that allosteric modulators or biased ligands may offer superior therapeutic windows compared to traditional orthosteric approaches .

How might therapeutic targeting of M1 receptors differ between Alzheimer's disease and schizophrenia based on receptor alterations specific to each condition?

Therapeutic targeting of M1 receptors requires distinct approaches for Alzheimer's disease (AD) and schizophrenia due to fundamental differences in receptor alterations and pathophysiology:

Alzheimer's Disease Strategy:

  • In AD, cholinergic neuron loss reduces endogenous acetylcholine, but M1 receptors remain relatively preserved in early disease stages .

  • Therapeutic focus: Potentiation of remaining cholinergic signaling through positive allosteric modulators (PAMs) or orthosteric agonists that can compensate for reduced acetylcholine levels .

  • Additional consideration: M1 receptor ligands that maintain receptor phosphorylation status show enhanced neuroprotective effects that may modify disease progression beyond symptomatic improvement .

  • Target outcome: Both cognitive enhancement and potential disease modification through regulation of amyloid precursor protein processing .

Schizophrenia Strategy:

  • In a subpopulation of schizophrenia patients termed "muscarinic receptor-deficit schizophrenia" (MRDS), there are marked (60-80%) reductions in cortical M1 receptor binding .

  • Therapeutic focus: Despite reduced receptor density, research shows increased efficacy of CHRM1-Gαq/11 coupling in MRDS, suggesting adaptive changes in receptor-G protein coupling efficiency .

  • This adaptive increase in coupling efficiency provides a potential therapeutic window where even with fewer receptors, appropriate ligands could effectively stimulate the remaining receptors.

  • Target outcome: Addressing the cognitive and negative symptoms of schizophrenia that respond poorly to current antipsychotic medications.

These condition-specific approaches highlight the importance of precise pharmacological targeting based on the underlying receptor pathology, with phosphorylation-maintaining compounds for AD and high-efficacy compounds leveraging enhanced coupling efficiency for MRDS .

What methodological approaches can distinguish between direct M1 receptor-mediated effects and indirect effects through receptor heterodimers or downstream crosstalk?

Distinguishing direct M1 receptor-mediated effects from indirect mechanisms requires sophisticated methodological approaches:

Genetic Approaches:

  • CRISPR/Cas9-mediated receptor mutations targeting specific interaction domains can disrupt heterodimer formation while preserving primary G protein coupling.

  • Conditional and cell-type-specific knockout models using Cre-loxP systems provide temporal and spatial control over M1 receptor expression, allowing for isolation of direct effects.

  • Knockin models expressing biased receptors (e.g., G protein-biased M1 receptors) can help differentiate between G protein and arrestin-dependent pathways .

Pharmacological Approaches:

  • Subtype-selective ligands combined with antagonists for potential interaction partners can pharmacologically isolate M1-specific effects.

  • The use of biased ligands that preferentially activate specific signaling pathways can help delineate mechanism-specific outcomes.

  • Time-course studies comparing rapid (likely direct) versus delayed (potentially indirect) effects following receptor activation.

Advanced Biochemical and Imaging Techniques:

  • Proximity ligation assays detect protein-protein interactions in native tissues, identifying heterodimer formation.

  • BRET/FRET approaches using labeled receptor constructs can monitor real-time formation of receptor complexes and recruitment of signaling components.

  • Phosphoproteomics combined with pathway inhibitors can map signaling cascades and identify points of crosstalk.

  • Super-resolution microscopy techniques (STORM, PALM) can visualize receptor nanocluster organization and colocalization.

When employing these approaches, researchers should include M1 receptor knockout controls for validation and consider that compensatory mechanisms may develop in genetic models . The [35S]-GTPγS-Gαq/11 immunocapture method has proven valuable for measuring direct receptor-G protein coupling in both recombinant systems and native tissues .

How do age-related changes in M1 receptor expression and function impact experimental outcomes in longitudinal studies of neurodegenerative mouse models?

Age-related changes in M1 receptor expression and function significantly impact experimental outcomes in longitudinal studies of neurodegenerative mouse models through multiple mechanisms:

Receptor Expression Dynamics:

  • Natural age-dependent decreases in M1 receptor density can confound interpretation of disease-specific changes.

  • Studies should include age-matched controls and consider normalizing data to account for baseline age-related decline.

  • The rate of receptor loss may accelerate in disease models, creating non-linear effects that require multiple measurement timepoints.

Signaling Efficiency Alterations:

  • Similar to observations in schizophrenia models, aging tissues may exhibit compensatory increases in coupling efficiency despite reduced receptor numbers .

  • This phenomenon can create misleading signals of treatment efficacy if only downstream effectors are measured without direct receptor quantification.

  • Research designs should incorporate direct measures of receptor-G protein coupling (such as [35S]-GTPγS-Gαq/11 binding) alongside functional outcomes .

Methodological Considerations:

  • Age-dependent changes in blood-brain barrier permeability affect drug delivery, potentially altering dose-response relationships over time.

  • Phosphorylation status of M1 receptors may change with age, affecting the balance between G protein and arrestin signaling .

  • As demonstrated in G protein-biased M1-receptor mice with accelerated neurodegeneration, these signaling shifts can significantly impact neuroprotective outcomes .

Practical Recommendations:

  • Include multiple age cohorts to distinguish disease progression from normal aging.

  • Examine both receptor density and functional coupling metrics at each timepoint.

  • Consider tissue-specific changes, as cortical and hippocampal regions may show differential age-related alterations.

  • When testing therapeutic compounds, reassess pharmacokinetics and target engagement at different ages.

  • Interpret behavioral outcomes in context of age-related changes in receptor function to avoid misattributing effects.

These considerations are essential for accurate interpretation of longitudinal data and development of age-appropriate therapeutic strategies for neurodegenerative conditions .

What is the relationship between M1 receptor phosphorylation patterns and amyloid precursor protein processing in models of Alzheimer's disease?

The relationship between M1 receptor phosphorylation patterns and amyloid precursor protein (APP) processing represents a critical mechanistic link in Alzheimer's disease pathophysiology:

M1 receptor activation through appropriately phosphorylated receptors promotes the non-amyloidogenic processing of APP through several interconnected mechanisms:

  • α-secretase activation: Properly phosphorylated M1 receptors preferentially couple to signaling pathways that enhance α-secretase activity, promoting cleavage of APP within the Aβ domain and preventing formation of amyloidogenic peptides .

  • PKC-dependent mechanisms: M1 receptor activation increases protein kinase C (PKC) activity, which phosphorylates components of the APP processing machinery, shifting processing toward the non-amyloidogenic pathway.

  • Phosphorylation-dependent signaling bias: Research with G protein-biased M1 receptor mouse models demonstrates that receptor phosphorylation status determines signaling pathway selection, with properly phosphorylated receptors activating neuroprotective pathways that reduce amyloid burden .

  • Altered trafficking: M1 receptor activation influences subcellular trafficking of APP, potentially reducing its processing in amyloidogenic compartments.

Studies using mutant M1 muscarinic receptor mice that express a G protein-biased form of the receptor (with altered phosphorylation properties) show accelerated neurodegenerative phenotypes, directly linking receptor phosphorylation status to disease progression . This suggests that therapeutic approaches targeting the M1 receptor should prioritize compounds that maintain appropriate receptor phosphorylation to optimize both cognitive enhancement and potential disease-modifying effects through favorable APP processing .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.