Recombinant Mouse Muscarinic acetylcholine receptor M3 (Chrm3)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Mouse Models

Research using Chrm3 knockout mice (generated via embryonic stem cell targeting) revealed:

Physiological Deficits:

  • Salivary Secretion: Near-complete loss (>90% reduction)

  • Pupillary Constriction: Impaired light reflex due to defective iris sphincter muscle contraction

  • Bladder Function:

    • Male mice: Severe urinary retention (95% loss of detrusor muscle contraction)

    • Female mice: Mild phenotype, suggesting sex-dependent regulatory mechanisms

Immune Modulation:

  • Upregulation of pro-inflammatory cytokines (IFN-γ, IL-17A) in memory T helper (Th) cells via NF-κB p65 activation

  • Atropine-sensitive reduction of anti-inflammatory IL-4

Research Applications and Tools

Recombinant Protein Variants:

Vendor/ProductHostApplicationsMolecular Weight
MyBioSource CHRM3 MammalianNeuroscience studies, ligand binding28.7 kDa (predicted)
Cloud-Clone RPB838Hu01 E. coliImmunogen, Western blot control14.7 kDa (theoretical)
CUSABIO CSB-EP005383HUb0 E. coliStructural studies, assay developmentNot specified

Antibodies:

  • Anti-CHRM3 antibodies (e.g., ab167566) validated for Western blot in human/mouse tissues

Key Research Findings

In Vivo Studies:

  • Bladder dysfunction in Chrm3⁻/⁻ mice highlights M3's dominance over other muscarinic subtypes (M2) in cholinergic detrusor contraction .

  • Salivary gland atrophy in knockouts confirms M3 as the primary mediator of parasympathetic secretion .

In Vitro Signaling:

  • M3 activation triggers phosphoinositide hydrolysis (PI turnover) and modulates potassium channels .

  • Redundant signaling pathways (e.g., ATP in bladder contraction) fail to compensate for M3 loss in males .

Immune Interactions:

  • M3 blockade suppresses NF-κB-driven inflammation in Th cells, suggesting therapeutic potential for autoimmune diseases .

Limitations and Unresolved Questions

  • Gastrointestinal and reproductive functions remain intact in Chrm3⁻/⁻ mice, implying compensation by other receptors (e.g., M2/M4) .

  • Species-specific differences: Human M3 mutations (e.g., Eagle-Barrett syndrome) show distinct phenotypes compared to mouse models .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for precise delivery times.
Note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
It is recommended to briefly centrifuge the vial prior to opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We advise adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life of the product depends on multiple factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
In general, liquid formulations have a shelf life of 6 months at -20°C/-80°C, while lyophilized formulations have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize the development of your specified tag.
Synonyms
Chrm3; Chrm-3; Muscarinic acetylcholine receptor M3; Mm3 mAChR
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-589
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MTLHSNSTTSPLFPNISSSWVHSPSEAGLPLGTVSQLDSYNISQTSGNFSSNDTSSDPLG GHTIWQVVFIAFLTGFLALVTIIGNILVIVAFKVNKQLKTVNNYFLLSLACADLIIGVIS MNLFTTYIIMNRWALGNLACDLWLSIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRT TKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAFY MPVTIMTILYWRIYKETEKRTKELAGLQASGTEAEAENFVHPTGSSRSCSSYELQQQGTK RSSRRKYGGCHFWFTTKSWKPSAEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSET RAIYSIVLKLPGHSTILNSTKLPSSDNLQVPDKDLGTMDVERNAHKLQAQKSMDDRDNCQ KDFSKLPIQLESAVDTAKTSDTNSSVDKTTAALPLSFKEATLAKRFALKTRSQITKRKRM SLIKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTYWNLGYWLCYINSTVNP VCYALCNKTFRTTFKMLLLCQCDKRKRRKQQYQQRQSVIFHKRVPEQAL
Uniprot No.

Target Background

Function
The muscarinic acetylcholine receptor mediates a range of cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides, and modulation of potassium channels via G protein interactions. The primary transduction effect is Pi turnover.
Gene References Into Functions
  1. M3-mAChR expression was downregulated in the myocardium of aged mice and D-galactose-treated mice, while the expression levels of caspase-1 and its downstream molecule IL-1beta were significantly elevated. PMID: 30196290
  2. Stimulation of the ERK pathway in Gnb5(-/-) cells by epidermal growth factor restored M3R-stimulated insulin release to near normal levels. The identification of the novel role of Gbeta5-R7 in insulin secretion may offer a new therapeutic approach for improving pancreatic beta-cell function. PMID: 28687610
  3. Furthermore, we observed that M3 cholinergic receptor (CHRM3) was upregulated in a substantial subset of benign prostatic hyperplasia (BPH) tissues compared to normal tissues. CHRM3 activation also promoted BPH cell proliferation. PMID: 27167157
  4. Early intervention with a cholinergic receptor muscarinic (ChRM)-3 blocker reversed the progression of airway hyperreactivity in a neonatal exposure model, whereas beta2-adrenoceptor agonists had no such effect. PMID: 28619712
  5. Our study demonstrated that knockout of the M2/3 receptor significantly inhibited ST37 acupuncture-induced enhancement of gastric motility, jejunal motility, and colonic motility. PMID: 27978539
  6. Type 3 muscarinic receptors contribute to intestinal mucosal homeostasis and clearance of Nippostrongylus brasiliensis through induction of TH2 cytokines. PMID: 27173511
  7. Arthritis-induced joint destruction was significantly more pronounced in mice with M3 muscarinic acetylcholine receptor deficiency. PMID: 26785775
  8. The effects of muscarinic receptor M3 knockout on cathepsin K expression, bone density, and biomechanical properties of bone are reported. PMID: 26002583
  9. The results suggest that autoantibodies against peptides of the second extracellular loop of M3R are not pathogenic in vivo and are not suitable as biomarkers for primary Sjögren's syndrome diagnosis. PMID: 26901532
  10. Expression of the M3 receptors mediating cholinergic contractile stimuli of the detrusor muscle was dysregulated in both Mras-/- males and females, although only males exhibited a urinary phenotype. PMID: 26516777
  11. The study screened CrkL binding proteins using RNA interference (RNAi) and identified Sorbs1 and Sorbs2 as two proteins enriched at AChR clusters, required for the formation of AChR aggregation in vitro. PMID: 26527617
  12. Activation of Chrm3 inhibits the recruitment of beta-arrestin-2 to odorant receptors, resulting in potentiation of odor-induced responses in olfactory sensory neurons. PMID: 25800153
  13. The muscarinic M3R receptor directly interacts with NOSTRIN at the plasma membrane in the aorta. PMID: 26169369
  14. Cholinergic signaling via the M3R is essential for optimal Th1 and Th2 adaptive immunity to infection. PMID: 25629518
  15. These findings indicate that the M(3) receptor on structural cells plays a proinflammatory role in CS-induced neutrophilic inflammation, whereas the M(3) receptor on inflammatory cells does not. PMID: 25381025
  16. Our results identify a novel candidate mouse gene, Zfp277, whose expression pattern is compatible with a role in mediating divergent effects of Chrm3 and Chrm1 gene ablation on murine intestinal neoplasia. PMID: 24694019
  17. M3 acetylcholine receptors are increased in beta cells as a mechanism to compensate for amino acid deficiency. PMID: 24695728
  18. This review highlights genetic modifications of muscarinic M3 receptor, which cause robust alterations in insulin levels and glucose tolerance. PMID: 24114586
  19. The upregulation of M-mAChR during myocardial hypertrophy could alleviate the hypertrophic response provoked by angiotensin II. PMID: 24028210
  20. Data suggest that acetylcholine contributes to allergen-induced remodeling and smooth muscle mass via the muscarinic M3 receptor. PMID: 24156289
  21. Activation of alpha2A-AR and muscarinic M3 receptors influences the initial [Ca(2+)] response to increasing glucose concentration from 3 to 20mM in BETA-cells. PMID: 24565843
  22. M2 receptors play a crucial role in generating intestinal rhythmic motor activity, while M3 receptors have a modulatory role in controlling the periodicity of the rhythmic activity. PMID: 23889852
  23. These results suggest that mAChRs in mouse colonic epithelial cells consist of two subtypes, M1 (80%) and M3 (20%). PMID: 23242454
  24. M3 receptor and VGLUT2 are co-localized on intraganglionic laminar endings of the esophagus. PMID: 23742744
  25. In murine ophthalmic arteries, the muscarinic M3 receptor subtype mediates cholinergic endothelium-dependent vasodilation and endothelium-independent vasoconstriction. PMID: 24408978
  26. Oscillatory Ca2+ increase in response to M3 muscarinic acetylcholine receptor stimulation is dependent upon a moderate IP3 increase, suitable for causing Ca(2+)-dependent IP3-induced Ca2+ release. PMID: 23747049
  27. The restricted M3 muscarinic receptors expression contributes to the propagation of Ca2+ signaling triggered by Acetylcholine. PMID: 23407022
  28. Immunization of muscarinic acetylcholine 3 receptor induces the secretion of IL-17 and IFN-gamma in NOD-scid mice. PMID: 23232510
  29. Blockage of mAChR exerts anti-inflammatory properties, and M3R plays a significant role in LPS-induced lung inflammation. PMID: 22910223
  30. Data suggest that although M3R is located on both myocardial cells and endocardial endothelial cells, only endothelial M3R mediates positive inotropy in response to muscarinic agonists via activation of cyclooxygenase 2 in the atrium. PMID: 22726658
  31. These results indicate that alpha7-nAChR are not involved in the regulation of bone collagen synthesis, whereas M3R exerts stimulatory effects on cancellous bone microarchitecture, flexural rigidity, and bone matrix synthesis. PMID: 22871384
  32. Studies with M3R mutant mice strongly suggest that strategies aimed at enhancing signaling through beta-cell M3R receptor may be beneficial in treating type 2 diabetes by promoting insulin release and generally improving beta-cell function. [review] PMID: 22525375
  33. Findings support the concept that the inhibitory effects of SPL on M3R activity are mediated by RGS4. PMID: 22730439
  34. M-mAChR overexpression significantly reduced the incidence of arrhythmias and decreased mortality in a mouse model of myocardial ischemia-reperfusion (I/R). PMID: 21785809
  35. The interplay of Chrm3 and beta-catenin signaling is crucial for intestinal mucosal differentiation and neoplasia. PMID: 21705482
  36. Caveolae disruption decreased muscarine-induced bronchoconstriction in wild-type and abolished it in M2R(-/-) and M3R(-/-) mice. Therefore, M2R and M3R signaling pathways require intact caveolae. PMID: 20023174
  37. M receptors mediate cholinergic vasodilation in cutaneous, skeletal muscle, and renal interlobar arteries. PMID: 21335473
  38. The expression of M3R in different cell types during skin wound healing is time-dependent. PMID: 20707271
  39. M(3)-muscarinic receptor-mediated augmentation of sustained insulin release is largely independent of G protein-coupling but involves phosphorylation-/arrestin-dependent coupling of the receptor to protein kinase D1. PMID: 21078968
  40. Results suggest that acetylcholine-M3 muscarinic receptor may be involved in itching associated with certain chronic pruritus diseases, such as atopic dermatitis. PMID: 20595784
  41. NF-kappaB signaling plays a critical role in controlling the expression of the muscarinic M(3) receptor. PMID: 20541544
  42. Determination of m2 and m3 muscarinic receptors in the central auditory system. PMID: 20665816
  43. Signaling through the M(3) muscarinic receptor promotes bone mass accrual by decreasing sympathetic activity. PMID: 20197056
  44. The M3-muscarinic receptor regulates learning and memory in a receptor phosphorylation/arrestin-dependent manner. PMID: 20439723
  45. Chrm3 plays a critical role in the liver injury response by modulating hepatocyte proliferation and apoptosis. PMID: 20197374
  46. M3 mAChRs distinguish parvalbumin-positive from cholecystokinin-positive basket cells; findings demonstrate that cell type-specific cholinergic specializations are present on neurochemically distinct interneuron subtypes in the hippocampus. PMID: 20427660
  47. RGS2 is an important cholinergic regulator in the atrium. RGS2(-/-) mice exhibit enhanced susceptibility to atrial fibrillation due to increased M3 muscarinic receptor activity. PMID: 19966055
  48. The role of M3 muscarinic receptor in smooth muscle contraction is analyzed in M3 knockout mice. PMID: 12486155
  49. When the muscarinic M3 receptor is deleted, cholinergic-induced relaxation is unmasked in the stomach fundus. PMID: 12538821
  50. The M3 mAChRs are involved in exocrine gland secretion, smooth muscle contractility, pupil dilation, food intake, and weight gain. Review. PMID: 12675128

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor 1 family, Muscarinic acetylcholine receptor subfamily, CHRM3 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Basolateral cell membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in cerebral cortex, submandibular gland, hypothalamus, pancreas, liver, and ileum.

Q&A

What is the primary signaling pathway associated with the muscarinic acetylcholine receptor M3?

The muscarinic acetylcholine receptor M3 primarily couples to the Gq/11 protein, which activates phospholipase C. This differentiates it from the M2 and M4 receptors that mainly couple to Gi/o protein, which inhibits adenylate cyclase activity. M3 receptor activation mediates various cellular responses, including breakdown of phosphoinositides and modulation of potassium channels through G protein action. The primary transducing effect is phosphatidylinositol (Pi) turnover . Understanding this signaling pathway is crucial for designing experiments that probe receptor function or screen for compounds that modulate specific downstream effects.

What physiological systems are most affected by Chrm3 knockout in mouse models?

Chrm3 knockout mouse models demonstrate several pronounced phenotypes in specific organ systems. Studies have conclusively demonstrated that the M3 receptor subtype plays key roles in salivary secretion, pupillary constriction, and bladder detrusor contractions . Interestingly, despite expression in digestive and reproductive organs, M3-mediated signals appear dispensable in these systems, likely due to redundant mechanisms through other muscarinic acetylcholine receptor subtypes or alternative mediators . This selective phenotypic expression makes Chrm3 knockout mice particularly valuable for studying autonomic regulation in specific tissues while minimizing confounding systemic effects.

What are the molecular mechanisms underlying sex differences in M3 receptor-mediated bladder function?

Chrm3 knockout studies have revealed a striking sexual dimorphism in urinary function, with prominent urinary retention observed only in male mice . This indicates a considerable sex difference in the micturition mechanism that appears to be M3 receptor-dependent. The molecular basis for this difference likely involves hormonal influences on receptor expression, downstream signaling efficiency, or compensatory mechanisms. Researchers investigating this phenomenon should consider experimental designs that control for hormonal status and include age-matched cohorts of both sexes. Quantitative analysis of receptor expression, G-protein coupling efficiency, and second messenger generation in bladder tissues from both sexes would help elucidate the mechanistic basis of this dimorphism.

How can researchers distinguish between M3-specific effects and redundant mechanisms through other muscarinic receptor subtypes?

When studying muscarinic receptor function, distinguishing M3-specific effects from those mediated by other subtypes presents a significant challenge due to the overlapping expression and partial functional redundancy of these receptors. A comprehensive approach should combine:

  • Pharmacological profiling using subtype-selective antagonists (though perfect selectivity is rarely achieved)

  • Genetic models with targeted receptor deletions (single and multiple knockouts)

  • Tissue-specific conditional knockout approaches

  • siRNA-mediated knockdown with validation of subtype-specific reduction

  • Quantitative expression analysis of all muscarinic receptor subtypes to detect compensatory changes

This multi-faceted approach allows researchers to determine which physiological responses are truly M3-dependent versus those that can be maintained through alternative muscarinic or non-muscarinic pathways .

What explains the dual role of M3 receptors in vascular contraction and dilation depending on endothelial presence?

Functional studies have demonstrated a fascinating dichotomy in M3 receptor-mediated vascular responses: acetylcholine evokes vasoconstriction in endothelium-removed arteries but produces vasodilation in vessels with intact endothelium . This dual functionality appears to be mediated through the same M3 receptor subtype, as both responses are dramatically attenuated in M3R−/− mice. The mechanisms likely involve:

  • Endothelial M3 receptors triggering nitric oxide production, leading to smooth muscle relaxation

  • Direct smooth muscle M3 receptor activation causing contraction through increased intracellular calcium

  • Different G-protein coupling preferences in endothelial versus smooth muscle cells

  • Distinct second messenger systems that predominate in each cell type

Researchers should carefully consider endothelial integrity in experimental designs and validate endothelial removal techniques when studying vascular muscarinic signaling .

What are the optimal techniques for validating recombinant Chrm3 expression in experimental systems?

Validating recombinant Chrm3 expression requires a multi-parameter approach:

Molecular Validation:

  • RT-PCR and qPCR for mRNA quantification

  • Western blotting using validated antibodies (predicted band size: 66 kDa)

  • Immunofluorescence for localization studies

Functional Validation:

  • Calcium mobilization assays (given Gq/11 coupling)

  • Phosphoinositide hydrolysis measurement

  • Electrophysiological assessment of potassium channel modulation

For Western blotting specifically, researchers should use antibodies at appropriate concentrations (e.g., 1 μg/mL for the Anti-Muscarinic Acetylcholine Receptor M3/CHRM3 antibody) and include both positive controls (Chrm3-transfected cell lysates) and negative controls . Predicted band detection at 66 kDa confirms appropriate receptor identification, though post-translational modifications may cause slight migration variations.

How should researchers design experiments to study compensatory mechanisms in Chrm3 knockout models?

When investigating compensatory mechanisms in Chrm3 knockout models, consider the following experimental design elements:

  • Developmental timing assessment:

    • Compare acute (pharmacological) versus chronic (genetic) receptor inactivation

    • Implement inducible knockout systems to distinguish between developmental and acute compensatory changes

  • Comprehensive receptor profiling:

    • Quantify expression changes in all muscarinic receptor subtypes (M1-M5)

    • Assess changes in receptor density using radioligand binding

  • Signaling pathway analysis:

    • Measure activity of alternative G-protein mediated pathways

    • Evaluate changes in calcium handling and second messenger systems

  • Tissue-specific investigations:

    • Focus on organs with known M3 function (salivary glands, pupils, bladder)

    • Compare with tissues showing minimal phenotypic changes despite M3 expression

  • Functional redundancy testing:

    • Apply selective agonists/antagonists for other receptor subtypes

    • Create double or triple knockout models to eliminate potentially redundant subtypes

This comprehensive approach will help distinguish between true physiological redundancy, compensatory upregulation, and activation of alternative signaling pathways .

What considerations are important when using anti-Chrm3 antibodies in research applications?

When utilizing anti-Chrm3 antibodies, researchers should address several critical factors:

Antibody Validation:

  • Confirm specificity using tissues/cells from Chrm3 knockout models

  • Perform peptide competition assays to verify target epitope binding

  • Compare results across multiple antibodies targeting different receptor domains

Application-Specific Optimization:

  • For Western blotting: Use appropriate antibody concentration (e.g., 1 μg/mL) and secondary antibody dilution (e.g., 1/2500 for HRP-conjugated antibodies)

  • For immunohistochemistry: Optimize fixation protocols to preserve membrane protein structure

  • For immunoprecipitation: Test detergent conditions that preserve receptor conformation

Experimental Controls:

  • Include Chrm3-transfected cell lysates as positive controls

  • Use non-transfected lysates as negative controls

  • For predicted band size, expect detection at approximately 66 kDa

These considerations will minimize false positives and ensure reliable detection of Chrm3 in experimental settings .

How should researchers interpret contradictory findings between in vitro and in vivo M3 receptor studies?

Discrepancies between in vitro and in vivo findings regarding M3 receptor function are common and require careful interpretation. For example, studies have shown in vitro defects in ileal muscle contraction in Chrm3 knockout models, yet the same animals do not suffer from apparent gastrointestinal disorders in vivo . When encountering such contradictions:

  • Evaluate physiological context:

    • Consider compensatory mechanisms that may operate in vivo but not in vitro

    • Assess contributions from the enteric nervous system and other regulatory systems

  • Examine experimental conditions:

    • Compare agonist concentrations between systems (physiological vs. supraphysiological)

    • Evaluate timing differences (acute vs. chronic responses)

  • Consider multifactorial regulation:

    • Analyze contributions from multiple receptor subtypes

    • Assess involvement of non-cholinergic pathways

  • Develop integrated models:

    • Design experiments that bridge in vitro and in vivo approaches

    • Implement ex vivo organ bath studies as an intermediate approach

This systematic evaluation will help reconcile apparently contradictory findings and develop more accurate models of M3 receptor function across experimental systems .

What factors should be considered when comparing phenotypes between different Chrm3 knockout mouse strains?

When comparing phenotypes between different Chrm3 knockout strains, researchers should consider:

Genetic Background Effects:

  • Pure vs. mixed genetic backgrounds (e.g., 129/SvJ, C57BL/6)

  • Number of backcrosses to achieve congenicity

  • Potential flanking gene effects from the targeting strategy

Knockout Strategy Variations:

  • Complete gene deletion vs. partial deletion (e.g., deletion of specific exons)

  • Constitutive vs. conditional knockout approaches

  • Presence of selection markers that might influence expression of nearby genes

Experimental Condition Standardization:

  • Age and sex of animals used

  • Housing conditions and environmental factors

  • Methodological approaches for phenotypic assessment

Control Selection:

  • Use of appropriate littermate controls

  • Consideration of heterozygous animals for gene dosage effects

  • Inclusion of multiple control strains when appropriate

These considerations are crucial for accurate interpretation, as phenotypic variability between supposedly similar knockout models can arise from subtle differences in these factors rather than from true biological variability in M3 receptor function .

How can researchers differentiate between primary effects of M3 receptor activation and secondary compensatory responses?

Distinguishing primary M3 receptor-mediated effects from secondary adaptive responses requires sophisticated experimental approaches:

  • Temporal analysis:

    • Implement time-course studies following receptor activation

    • Use rapid-acting agonists with defined pharmacokinetics

    • Compare immediate (<1 minute) with delayed responses

  • Signaling pathway dissection:

    • Apply specific inhibitors of known downstream effectors

    • Utilize FRET-based sensors for real-time second messenger monitoring

    • Implement genetic approaches that selectively disrupt specific signaling branches

  • Direct vs. indirect mechanisms:

    • Perform studies in isolated cells vs. intact tissues

    • Use cell type-specific receptor deletion models

    • Implement optogenetic approaches for precise temporal control

  • Adaptation mechanisms:

    • Study receptor desensitization, internalization, and recycling

    • Analyze changes in receptor phosphorylation status

    • Examine scaffold protein recruitment following activation

These approaches will help differentiate between immediate signaling consequences of M3 receptor activation and the subsequent adaptive responses that may involve complex cellular and tissue-level reorganization .

How can Chrm3 knockout mouse models inform our understanding of human diseases involving cholinergic dysfunction?

Chrm3 knockout mice represent valuable models for investigating human diseases with altered cholinergic function. Research indicates these models may have particular relevance for:

  • Ocular disorders:

    • The phenotype resembles aspects of bilateral congenital mydriasis (OMIM #159420)

    • Potential applications in glaucoma research due to effects on pupillary function

  • Urological dysfunction:

    • Male-specific urinary retention phenotypes inform sex differences in bladder disorders

    • Applications in studying neurogenic bladder conditions

  • Salivary dysfunction:

    • Models of dry mouth conditions (xerostomia)

    • Testing interventions for salivary hypofunction

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.