Recombinant Mouse Muscarinic acetylcholine receptor M5 (Chrm5)

Shipped with Ice Packs
In Stock

Description

Production Systems for Recombinant Chrm5

Recombinant mouse Chrm5 is expressed in multiple heterologous systems to study ligand interactions, signaling, and drug discovery. Common platforms include:

Expression SystemAdvantagesApplications
E. coliCost-effective, high yieldAntigen production, antibody development
YeastEukaryotic post-translational modificationsFunctional studies
BaculovirusHigh protein yield, proper foldingStructural biology, ligand screening
Mammalian CellsNative-like glycosylation and foldingPharmacological assays, receptor trafficking

Source:

Neurological and Behavioral Roles

  • Cognitive Function: M5 receptors enhance cerebral blood flow in the hippocampus and cortex, critical for memory formation . Knockout mice exhibit deficits in hippocampus-dependent tasks .

  • Substance Use Disorders: M5 receptor deletion reduces drug-seeking behavior, suggesting therapeutic potential for cocaine and alcohol addiction .

  • Schizophrenia: Polymorphisms in Chrm5 correlate with dopamine dysregulation, implicating M5 in psychosis pathways .

Peripheral Functions

  • Immune Modulation: M5 receptors are upregulated in lymphocytes during immune responses .

  • Bladder Function: M5 regulates urethral brush cell activity, with dysfunction linked to overactive bladder .

Antibodies and Detection

  • Western Blot: Anti-Chrm5 antibodies (e.g., ab167567) detect a ~60 kDa band in transfected 293T cells .

  • Flow Cytometry: Extracellular epitope-specific antibodies (e.g., AMR-005) confirm surface expression in Jurkat T-cells .

Recombinant Protein Variants

  • His6-Tagged Antigens: Used in competition assays to validate antibody specificity .

  • Biotinylated Forms: Enable high-sensitivity detection in pull-down assays .

Therapeutic Implications

  • Alzheimer’s Disease: M5 agonists may improve cerebral blood flow and cognition .

  • Substance Use Disorders: Negative allosteric modulators (e.g., ML375) reduce ethanol and cocaine reinforcement .

  • Interstitial Cystitis: M5 antagonists could mitigate bladder overactivity .

Challenges and Future Directions

  • Low Native Expression: M5 is less abundant than other muscarinic subtypes, complicating endogenous detection .

  • Ligand Specificity: Few selective M5 agonists/antagonists exist, necessitating high-throughput screening .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes, and we will fulfill your requirements whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference point.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer composition, temperature, and the protein's inherent stability.
In general, the shelf life of liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you have a preferred tag type, please inform us, and we will prioritize its inclusion in the development process.
Synonyms
Chrm5; Muscarinic acetylcholine receptor M5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-532
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MEGESYHNETTVNGTPVNHQALERHGLWEVITIAAVTAVVSLMTIVGNVLVMISFKVNSQ LKTVNNYYLLSLACADLIIGIFSMNLYTTYILMGRWVLGSLACDLWLALDYVASNASVMN LLVISFDRYFSITRPLTYRAKRTPKRAGIMIGLAWLVSFILWAPAILCWQYLVGKRTVPP DECQIQFLSEPTITFGTAIAAFYIPVSVMTILYCRIYRETEKRTKDLADLQGSDSVAEVK KRKPAHRTLLRSFFSCPRPSLAQRVRNQASWSSSRRSTSTTGKPTQATDLSADWEKAEQV TNCSSCPSSEDEAKATTDPVFQVVCKNEAKESPGKEFNTQETKETFVSPRTENNDYDTPK YFLSPGAAHRLKSQKCVAYKFRLVVKADGTQETNNGCRKVKIMPCSFPVSKDPSTKGLDP HLSHQMTKRKRMVLVKERKAAQTLSAILLAFIITWTPYNIMVLVSTFCDKCVPVTLWHLG YWLCYVNSTINPICYALCNRTFRKTFKLLLLCRWKKKKVEEKLYWQGNSKLP
Uniprot No.

Target Background

Function
The muscarinic acetylcholine receptor mediates a variety of cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides, and modulation of potassium channels through the action of G proteins. The primary transducing effect is Pi turnover.
Gene References Into Functions
  1. Activation of M5 receptors in the striatum induces an inhibition in dopamine release. PMID: 24573284
  2. Mutant mice with a deletion in the third intracellular loop of the muscarinic M5 receptor gene exhibited increased drinking compared to wild-type mice, but feeding was not increased. PMID: 11900778
  3. Deletion attenuates morphine reinforcement and withdrawal but not morphine analgesia. PMID: 12154229
  4. M5 mAChRs modulate of central dopamine function and the tone of cerebral blood vessels. Review. PMID: 12675128
  5. Acetylcholine, a potent dilator of most vascular beds, virtually lost the ability to dilate cerebral arteries and arterioles in M5 muscarinic receptor -/- mice, suggesting that endothelial M(5) receptors mediate this activity in wild-type mice--review PMID: 14607263
  6. Male M5R-/- mice exhibited a significantly reduced cerebral blood flow (CBF) in the cerebral cortex, hippocampus, basal ganglia, and thalamus. Cortical and hippocampal pyramidal neurons from M5R-/- mice showed neuronal atrophy. PMID: 16956767
  7. Results suggest that M1 and M5 muscarinic cholinergic receptors are not involved in anti-viral immunity. PMID: 17286988
  8. M2 and M5 muscarinic receptors but not M4 muscarinic receptor or D2 dopamine receptors are needed for male USV production during male-female interactions PMID: 18382674
  9. In the absence of VTA M(5) receptors, ventral tegmental area cholinergic agent inputs inhibit locomotion. PMID: 18849356
Database Links
Protein Families
G-protein coupled receptor 1 family, Muscarinic acetylcholine receptor subfamily, CHRM5 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of the mouse Chrm5 receptor and how does it compare to the human M5 receptor?

The mouse Muscarinic acetylcholine receptor M5 (Chrm5) is a seven transmembrane glycoprotein consisting of 532 amino acid residues, which is 89% homologous to the human M5 receptor (531 residues). Structurally, the M5 receptor is the next largest muscarinic receptor after the M3 subtype, with both possessing a large third intracellular loop. This cytoplasmic loop accounts for most of the sequence diversity between muscarinic receptor subtypes and between species. Of all five muscarinic receptors, the M5 subtype demonstrates the least homology in this region when comparing human and rat sequences .

What are the primary signaling pathways associated with Chrm5?

Chrm5, like M1 and M3 receptors, couples preferentially via the pertussis toxin-insensitive Gq/11 protein to phosphoinositide C-β (PLC-β). Activation of these receptors accelerates the hydrolysis of phosphatidylinositol 4,5-bisphosphate (PIP2), leading to the formation of inositol 1,4,5-trisphosphate (InsP3) and diacylglycerol (DAG). These second messengers then mobilize Ca2+ from intracellular stores and activate protein kinase C (PKC), respectively . This signaling cascade was first observed by Bonner et al. (1988) in recombinant muscarinic M5 receptors expressed in CHO cells, and has been confirmed in subsequent studies .

Where is Chrm5 predominantly expressed in the mouse brain?

The Chrm5 receptor exhibits a distinct expression pattern compared to other muscarinic receptor subtypes in the brain. Chrm5 is primarily localized to:

  • Substantia nigra pars compacta

  • Ventral tegmental area

  • Hippocampus (particularly CA1 and CA2 subfields)

  • Cerebral cortex (outermost layer)

  • Striatum (caudate putamen)

This expression pattern has been identified using in situ hybridization and reverse-transcriptase PCR techniques, as selective high-affinity ligands for M5 receptors are not available .

What is the genetic structure of the mouse Chrm5 gene?

The Chrm5 gene undergoes alternative splicing, producing two transcripts (CHRM5.a and CHRM5.b) that contain a common 3'-coding exon and three alternatively spliced 5'-untranslated exons. Both transcripts contain the coding exon 4, with alternative splicing occurring in the 5' untranslated region. Alignment of CHRM5.a onto the chromosome reference sequence reveals a gene structure of two exons: a 5' untranslated exon and a 3' exon containing both coding and untranslated regions .

What phenotypes are observed in Chrm5 knockout mice?

Chrm5 knockout (KO) mice exhibit several distinctive phenotypes:

  • Viability and fertility: Chrm5 KO mice are viable and fertile with no major morphological abnormalities .

  • Cognitive function: They show deficits in hippocampus-dependent cognitive tasks, consistent with Chrm5's role in contributing to the cognitive-enhancing effects of acetylcholine .

  • Cerebral blood flow: KO mice exhibit reduced cerebral blood flow in the cerebral cortex and hippocampus, consistent with the observation that Chrm5 mediates acetylcholine-induced dilation of cerebral blood vessels .

  • Drug response: The most notable phenotype is substantially reduced reward and withdrawal responses to morphine and cocaine, demonstrating Chrm5's role in regulating drug-seeking behavior .

  • Sensorimotor gating: The Chrm5 KO mutation appears to exert a stabilizing effect on sensorimotor gating in intact mice, which is decreased in schizophrenia .

What techniques are most effective for studying Chrm5 expression in brain tissue?

Several techniques have proven effective for studying Chrm5 expression:

  • In situ hybridization: Due to the lack of selective high-affinity ligands, in situ hybridization has been essential for mapping Chrm5 expression patterns in the brain .

  • Reverse-transcriptase PCR (RT-PCR): RT-PCR is commonly used to quantify Chrm5 mRNA expression levels across different brain regions or under various experimental conditions .

  • Fluorescent in situ hybridization (FISH): FISH provides a powerful approach for examining Chrm5 expression in specific neuronal populations. For example, it has been used to examine Chrm5 expression in ventral subiculum neurons that project to the nucleus accumbens shell (vSub→AcbSh) .

  • Primer design for Chrm5 detection: For accurate quantification, researchers should design primers using tools like Primer3 software based on coding DNA sequences from GenBank, and verify primer specificity using BLAST to ensure selective amplification of Chrm5 .

How can researchers establish the specificity of their measurements when studying Chrm5?

Due to the lack of specific pharmacological tools for Chrm5, researchers should employ multiple complementary approaches:

  • Genetic validation: Using Chrm5 KO mice as negative controls to validate antibody specificity or expression analysis methods.

  • Multiple primer sets: When using PCR-based methods, designing and testing multiple primer sets targeting different regions of Chrm5 mRNA.

  • Cross-validation of techniques: Combining protein-level (if antibodies are available) and mRNA-level detection methods.

  • Controls for off-target effects: When using pharmacological approaches, implementing appropriate controls with less selective compounds.

How does Chrm5 modulate dopaminergic neurotransmission in addiction models?

Chrm5 receptors are strategically located in dopamine-containing neurons of the substantia nigra pars compacta and ventral tegmental area, where they regulate the release of mesolimbic dopamine . In addiction models:

  • Chrm5 activation enhances dopamine release in the nucleus accumbens and striatum, regions critical for reward processing.

  • Mice lacking functional Chrm5 show reduced self-administration of cocaine compared to wild-type controls, suggesting diminished reward perception .

  • The absence of Chrm5 appears to decrease the duration of forebrain dopamine transmission, affecting the maintenance of dopamine-related reward .

  • The rewarding effects of morphine, as measured using conditioned place preference tests, are greatly reduced in Chrm5 KO mice .

These findings collectively suggest that Chrm5 plays a crucial role in modulating the behavioral manifestations of drug reward and withdrawal by stimulating dopamine release .

What changes in Chrm5 expression occur following chronic drug exposure?

Research has demonstrated that Chrm5 expression is dynamically regulated in response to drug exposure:

  • Alcohol consumption: Chrm5 is upregulated following long-term alcohol consumption, while the related muscarinic receptor Chrm4 is downregulated following long-term alcohol consumption and abstinence .

  • Potential for neuroadaptation: These expression changes suggest that altered Chrm5 function may contribute to neuroadaptations underlying addiction and withdrawal.

  • Region-specific regulation: These changes may be region-specific, with different patterns of regulation in structures like the ventral subiculum compared to other brain regions.

What experimental design considerations are important when using Chrm5 KO mice in addiction studies?

When designing experiments with Chrm5 KO mice in addiction studies, researchers should consider:

  • Compensatory mechanisms: Developmental compensation in constitutive knockouts may mask the full effects of Chrm5 deletion. Consider using conditional or inducible knockout models if available.

  • Background strain effects: The genetic background of the mice can significantly influence behavioral phenotypes. Use appropriate littermate controls and consider backcrossing to a well-characterized strain.

  • Sex differences: Include both male and female mice in studies, as sex differences in addiction-related behaviors and Chrm5 function may exist.

  • Multiple behavioral assays: Employ multiple behavioral paradigms to assess addiction-related phenotypes, such as:

    • Conditioned place preference

    • Self-administration

    • Progressive ratio schedules

    • Withdrawal measures

    • Reinstatement paradigms

  • Physiological validation: Include measures of dopamine release or electrophysiological recordings to correlate behavioral outcomes with neurobiological changes.

How might Chrm5 be targeted therapeutically in addiction treatment?

Based on the evidence that Chrm5 modulates reward processing and drug-seeking behavior, several therapeutic approaches may be considered:

  • Selective antagonism: Development of selective M5R antagonists might reduce drug reward and craving behaviors. Historical use of non-selective muscarinic antagonists like scopolamine for opiate addiction suggests potential efficacy .

  • Allosteric modulation: Negative allosteric modulators specific to M5R might provide a more nuanced approach with fewer side effects than orthosteric antagonists.

  • Combined approaches: Targeting M5R in combination with other addiction-relevant receptors might produce synergistic therapeutic effects.

  • Genetic approaches: While not immediately translatable to humans, genetic interventions targeting Chrm5 expression could provide proof-of-concept for the development of RNA-based therapeutics.

The development of M5R-targeted therapies is complicated by the lack of highly selective ligands, but recent advances in structural biology and medicinal chemistry may facilitate progress in this area .

What are the key unresolved questions regarding Chrm5 function in addiction?

Several important questions remain to be addressed:

  • Regional specificity: How do Chrm5 receptors in different brain regions (ventral tegmental area vs. substantia nigra vs. hippocampus) differentially contribute to addiction-related behaviors?

  • Temporal dynamics: What is the time course of Chrm5-mediated modulation of dopamine release, and how does this relate to different phases of addiction (acquisition, maintenance, withdrawal, relapse)?

  • Interactions with other systems: How does Chrm5 interact with other neurotransmitter systems involved in addiction, such as glutamate, GABA, or other neuromodulators?

  • Human relevance: To what extent do findings from mouse models translate to human addiction, and are there polymorphisms in human CHRM5 that influence addiction vulnerability?

What emerging technologies might advance Chrm5 research?

Several cutting-edge approaches could significantly advance our understanding of Chrm5 function:

  • CRISPR-based approaches: For creating more sophisticated knockout or knockin models.

  • Optogenetics and chemogenetics: To achieve temporally precise and cell-type-specific manipulation of neurons expressing Chrm5.

  • Single-cell transcriptomics: To better characterize the molecular profile of Chrm5-expressing neurons and how they change with drug exposure.

  • PET imaging with selective radiotracers: Development of Chrm5-selective PET ligands would enable in vivo imaging of receptor distribution and occupancy.

  • Structure-based drug design: As structural information about Chrm5 becomes available, rational design of selective ligands becomes more feasible.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.