Recombinant Mouse Myc target protein 1 (Myct1)

Shipped with Ice Packs
In Stock

Description

General Information

MYC Target 1 (MYCT1), also known as MTLC, is a protein that plays a crucial role in regulating various cellular processes . It is selectively expressed in undifferentiated human hematopoietic stem and progenitor cells (HSPCs) and endothelial cells, but its expression decreases during HSC culture . In mouse models, Myct1 has been identified as a direct target of the ETS transcription factor ETV2, which is critical for vascular development, regeneration, and tumor development .

Role in Hematopoietic Stem Cells (HSCs)

MYCT1 is essential for preserving human HSC stemness by moderating endocytosis and environmental sensing in HSCs . Studies have shown that:

  • Knockdown of MYCT1 prevented the expansion and engraftment of human fetal liver and cord blood (CB) HSPCs .

  • Restoring MYCT1 expression improved the expansion and engraftment of cultured CB HSPCs .

  • MYCT1 governs regulatory programs and cellular properties vital for HSC stemness, such as ETS factor expression and low mitochondrial activity .

  • MYCT1 is localized in the endosomal membrane in HSPCs and interacts with vesicle trafficking regulators and signaling machinery .

  • Loss of MYCT1 in HSPCs leads to excessive endocytosis and hyperactive signaling responses, while restoring MYCT1 expression balances culture-induced endocytosis and dysregulated signaling .

Function in Tumor Biology

In tumor biology, MYCT1 plays a dual role in tumor angiogenesis and the tumor microenvironment . Research indicates that:

  • Myct1 KO mice showed an increased M1-macrophage population and a decreased M2-macrophage population, increasing the ‘M1-to-M2 ratios’ in tumor models .

  • Low MYCT1 expression in tumor samples is associated with decreased FOXP3 expression (a marker for regulatory T cells) and an increased ‘M1-to-M2 ratio’ .

  • Myct1 deficiency in tumor endothelial cells promotes an anti-tumor immune microenvironment .

The combined blockade of Myct1 and VEGF receptor 2 (VEGFR2) resulted in complete tumor regression in treated mice .

Interaction with Other Proteins

MYCT1 interacts with other proteins, influencing Myc-driven carcinogenesis . Notable interactions include:

  • Miz-1: This transcription factor can reverse the transcriptional activities of c-Myc. Miz-1 competes with Max to form a complex with c-Myc and can interact with the zinc-finger transcriptional repressor growth factor independence 1 (Gfi-1), forming a ternary complex that represses CDKN synergistically .

  • PP1/PNUTS: The binding of PP1/PNUTS with Myc enriches Myc-Max and Myc-PP1/PNUTS on Myc target gene promoters. Inhibition of PP1/PNUTS induces hyperphosphorylation of Myc, leading to its degradation .

Role in Environmental Sensing

MYCT1 moderates endocytosis and environmental sensing in HSCs, which is crucial for maintaining HSC stemness .

Inhibition of MycP1 Protease

Mycosin protease-1 (MycP1) is a serine protease crucial for hydrolyzing the virulence factor ESX-secretion-associated protein B (EspB) in Mycobacterium tuberculosis . Virtual screening has identified novel, nonpeptide, small-molecule inhibitors against MycP1 protease. These inhibitors have shown micromolar IC50 values against the MycP1 target, underscoring the value of combining in silico iterative ligand- and structure-based virtual screening with experimental validation for identifying promising structural scaffolds .

Clinical Significance

MYCT1 is associated with drug-resistant Mycobacterium tuberculosis, which highlights the urgency for new tuberculosis treatment options . Targeting MYCT1 could offer new therapeutic strategies for Myc-driven cancers .

Table 1: Effects of MYCT1 on Tumor Regression

TreatmentResult
Anti-PD1 (late-onset) in Myct1 KO miceDramatic tumor regression within 12 days of treatment initiation, leading to complete tumor regression in most mice (7 out of 8)
Combined anti-PD1 and anti-Myct1Restricted tumor progression in all treated mice, with complete regression in 25% of the mice (2 out of 8)
Anti-PD1 with dual blockade of Myct1 and VEGFR2Complete tumor regression in all treated mice
Prolonged anti-Myct1 treatmentRestriction of tumor progression for a longer period, with about 60% of mice showing complete tumor regression (14 out of 24 mice)

Table 2: MYCT1 Expression and HSC Stemness

GeneEffect of MYCT1 Expression
MLLT3Significantly higher expression
HIF1ASignificantly higher expression
MEIS1Significantly higher expression
CDK6Lower expression

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Myct1; Mtmc1; Myc target protein 1; Myc target in myeloid cells protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-188
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Myct1
Target Protein Sequence
MANNTTSLGSPWPENFWEDLIMSFTVSVAIGLAIGGFLWALFVFLSRRRRASAPISQWSP TRRPRSSYNHGLNRTGFYRHSGYERRSNLSLASLTFQRQASMELVNSFPRKSSFRASTFH PFLQCPPLPVETESQLMTLSASTTPSTLSTAHSPSRPDFRWSSNSLRMGLSTPPPPAYES IIKAFPDS
Uniprot No.

Target Background

Function
May regulate select MYC target genes; MYC appears to be a direct upstream transcriptional activator. It does not significantly affect cell growth capacity. Overexpression appears to mediate many phenotypic features associated with MYC, including apoptosis induction, morphological changes, enhanced anchorage-independent growth, tumorigenic transformation, genomic instability promotion, and hematopoietic differentiation inhibition.
Gene References Into Functions
  1. The effects of MT-MC1 result from its regulation of a select population of c-Myc target genes. PMID: 16365299
Database Links
Protein Families
MYCT1 family
Subcellular Location
Nucleus membrane; Single-pass membrane protein.
Tissue Specificity
Highly expressed in lung, heart, and skeletal muscle. Expressed in brain, eye, liver, kidney, smooth muscle, pancreas, thyroid, thymus, submaxillary gland, spleen, testis, ovary, prostate, epididymis, and uterus. Deregulated expression promotes apoptosis

Q&A

What is Myct1 and what are its primary cellular functions?

Myct1 (MYC Target 1, also known as MTLC) is a direct target gene of c-Myc that functions as a multifaceted regulatory protein. It serves as a selective translational regulator of glycogen metabolizing enzymes through interactions with RACK1, a crucial factor in ribosomal translation . Myct1 is nearly exclusively expressed in endothelial cells and undifferentiated hematopoietic stem and progenitor cells (HSPCs) .

The protein plays critical roles in:

  • Regulating glycogen metabolism via the glycogen shunt pathway

  • Controlling tumor angiogenesis and reprogramming tumor immunity

  • Moderating endocytosis and environmental sensing in hematopoietic stem cells

  • Functioning as a tumor suppressor in certain cancer types

Research approaches to characterize Myct1 typically involve knockout/knockdown models, overexpression systems, and co-immunoprecipitation followed by mass spectrometry to identify interacting partners.

How is Myct1 expression regulated in different physiological contexts?

Myct1 expression is tightly regulated through multiple mechanisms:

  • Transcriptional regulation: Myct1 is a direct target of the ETS transcription factor ETV2, which is critical for vascular development, regeneration, and tumor angiogenesis . As a c-Myc target gene, its expression is also influenced by c-Myc activity .

  • Epigenetic regulation: Hypermethylation of the Myct1 promoter has been observed in certain pathological conditions, such as acute myeloid leukemia (AML), resulting in downregulation of Myct1 expression .

  • Context-dependent expression: Myct1 is selectively expressed in undifferentiated human HSPCs and endothelial cells but becomes markedly downregulated during HSC culture . This context-dependent expression suggests that Myct1 may serve as a marker for stemness in certain cell populations.

To study Myct1 regulation, researchers should consider employing methylation analysis, chromatin immunoprecipitation (ChIP) assays, and reporter gene assays to elucidate the specific regulatory mechanisms in their system of interest.

What are the optimal approaches for modulating Myct1 expression in experimental systems?

Researchers have successfully employed several methods to modulate Myct1 expression:

For Myct1 knockdown:

  • Lentiviral short hairpin RNA (shRNA) delivery has been effectively used to achieve sustained Myct1 knockdown in human cord blood HSPCs and fetal liver HSPCs .

  • siRNA-peptide nanoparticle approaches provide an alternative for systemic Myct1 targeting in vivo .

For Myct1 overexpression:

  • Lentiviral particles carrying the complete CDS of Myct1 gene have been successfully used to mediate forced overexpression in various cell types, including AML cell lines (HL-60 and KG-1a) .

  • Intratumoral injection of Myct1 lentivirus has demonstrated efficacy in repressing tumor growth in xenograft models .

When designing Myct1 modulation experiments, it's critical to include appropriate controls and validate knockdown or overexpression efficiency at both mRNA and protein levels. Cell-type specific responses to Myct1 modulation should be anticipated and carefully monitored.

How can researchers effectively assess Myct1 protein interactions and subcellular localization?

Myct1 protein interactions and localization can be studied through several complementary approaches:

For protein-protein interactions:

  • Co-immunoprecipitation followed by mass spectrometry has successfully identified Myct1 interactors centered on translation and translation initiation regulation .

  • Confirmation of specific interactions can be performed by targeted co-immunoprecipitation, as demonstrated for Myct1 and RACK1 in both liver and HepG2 cells .

For subcellular localization:

  • Immunofluorescence staining has revealed that Myct1 is localized in the endosomal membrane in HSPCs .

  • Co-localization studies with markers for specific cellular compartments (e.g., Myct1 with RACK1 and RPS3 for ribosomal association) provide insights into functional interactions .

For optimal results, researchers should verify antibody specificity through knockout/knockdown controls and employ multiple methodological approaches to confirm findings.

How does Myct1 regulate glycogen metabolism through translational control mechanisms?

Myct1 functions as a selective translational regulator of glycogen metabolizing enzymes through its interaction with RACK1, a component of the 40S ribosomal subunit . This regulation affects multiple aspects of the glycogen shunt pathway:

  • Enzyme translation control: Myct1 selectively regulates the translation of key glycogen metabolizing enzymes including PGM1, UGP2, and GSK3A. Myct1 overexpression upregulates these enzymes, while knockdown decreases their expression .

  • Metabolite flux alteration: Myct1-overexpressing cells show elevated G6P and UDP-glucose contents and lower glycogen and G1P contents, while Myct1-knockdown groups show the opposite pattern . This metabolic shift promotes the conversion from G1P to G6P, a central hub for glycolysis.

  • RACK1-dependent mechanism: The translational regulation by Myct1 is dependent on RACK1, as demonstrated by experiments where RACK1 knockdown attenuated the translation upregulation induced by Myct1 .

Research methodologies to study this regulation include polysome analysis followed by Western blotting to assess ribosomal association of RACK1, metabolite quantification to track glycogen shunt intermediates, and translational efficiency (TE) measurements of specific mRNAs.

Table 1: Metabolite changes in glycogen shunt pathway upon Myct1 modulation

MetaboliteMyct1 OverexpressionMyct1 Knockdown
G6PIncreasedDecreased
UDP-glucoseIncreasedDecreased
GlycogenDecreasedIncreased
G1PDecreasedIncreased

What is the molecular basis for Myct1's interaction with RACK1 and how does this affect ribosome function?

Myct1 interacts with RACK1 to modulate ribosomal function through several mechanisms:

  • Direct physical interaction: Co-immunoprecipitation experiments in both liver and HepG2 cells have confirmed Myct1 and RACK1 as interacting partners .

  • Ribosomal recruitment: Myct1 affects the enrichment of RACK1 on ribosomes. Polysome analysis followed by Western blotting revealed marked differences in the amounts of RACK1 associated with monosomes and polysomes between wild-type and Myct1 knockout mice .

  • Translation specificity: The Myct1-RACK1 interaction appears to confer specificity for the translation of certain mRNAs, particularly those encoding glycogen metabolizing enzymes .

To effectively study these interactions, researchers should employ ribosome profiling techniques combined with Myct1/RACK1 modulation to identify specific mRNAs whose translation is affected. Additionally, structural studies could provide insights into the precise molecular interfaces mediating the Myct1-RACK1 interaction.

How does Myct1 influence tumor progression and angiogenesis?

Myct1 plays dual roles in tumor biology, affecting both angiogenesis and anti-tumor immunity:

  • Tumor angiogenesis regulation: Myct1 is nearly exclusively expressed in endothelial cells, and Myct1 deficiency reduces angiogenesis in preclinical mouse tumor models . This anti-angiogenic effect is not limited to tumors, as Myct1 knockout mice also showed lower blood perfusion recovery and neovascularization in a hindlimb ischemia injury model .

  • Endothelial cell function: Mechanistically, MYCT1 interacts with tight junction protein Zona Occludens 1 and regulates Rho GTPase-mediated actin cytoskeleton dynamics, thereby promoting endothelial motility in the angiogenic environment .

  • Tumor suppressor activity: In certain cancer contexts, such as laryngeal squamous cell carcinoma and acute myeloid leukemia, Myct1 appears to function as a tumor suppressor. Overexpression of Myct1 in AML cell lines inhibited cell proliferation, arrested cell cycle at G0/G1 phase, and triggered apoptosis .

Research approaches should include endothelial-specific knockout models, vascular permeability assays, and migration assays to fully characterize Myct1's role in tumor vasculature.

How can targeting Myct1 enhance cancer immunotherapy outcomes?

Targeting Myct1 shows significant potential for enhancing immunotherapy efficacy through multiple mechanisms:

  • Enhanced immune cell infiltration: Myct1 deficiency promotes an anti-tumor immune environment, characterized by enhanced high endothelial venule formation and improved immune cell infiltration .

  • Synergy with checkpoint inhibitors: Myct1 targeting combined with anti-PD1 treatment significantly increased complete tumor regression and long-term survival in both anti-PD1-responsive and -refractory tumor models in mice .

  • Translational relevance: Analysis of The Cancer Genome Atlas (TCGA) datasets revealed a significant correlation between MYCT1 expression, angiogenesis, and anti-tumor immunity in human cancers, with decreased FOXP3 expression and increased anti-tumor macrophages in patients with low MYCT1 expression .

Table 2: Tumor response to combined Myct1 targeting and immunotherapy

Treatment ApproachAnti-PD1 Responsive Model (Complete Regression Rate)Anti-PD1 Refractory Model (Complete Regression Rate)
Anti-PD1 monotherapyLimited responseNo response
Myct1 KO + Anti-PD17/8 mice (87.5%)Not tested
Myct1 siRNA + Anti-PD12/8 mice (25%)3/7 mice (43%)
Extended Myct1 siRNA + Anti-PD114/24 mice (58.3%)Not reported
Dual Myct1 siRNA + VEGFR2 blockade + Anti-PD18/8 mice (100%)7/8 mice (87.5%)

For optimal therapeutic development, researchers should investigate the timing and duration of Myct1 targeting relative to immunotherapy administration, as well as potential combination approaches with other vascular normalization strategies.

How does Myct1 regulate hematopoietic stem cell function and maintenance?

Myct1 serves as a crucial regulator of human hematopoietic stem cell (HSC) function through several mechanisms:

  • Endocytosis and environmental sensing: Myct1 moderates endocytosis and environmental sensing in HSCs. Loss of Myct1 in HSPCs leads to excessive endocytosis and hyperactive signaling responses, while restoring Myct1 expression balances culture-induced endocytosis and dysregulated signaling .

  • HSC expansion and engraftment: Knockdown of Myct1 prevents human fetal liver and cord blood HSPC expansion and engraftment, while restoring Myct1 expression improves the expansion and engraftment of cultured cord blood HSPCs .

  • Stemness program regulation: Single-cell RNA sequencing revealed that Myct1 governs important regulatory programs essential for HSC stemness, such as ETS factor expression and low mitochondrial activity .

  • Subcellular localization: Myct1 is localized in the endosomal membrane in HSPCs and interacts with vesicle trafficking regulators and signaling machinery .

Research methodologies should include in vivo transplantation assays, single-cell analyses, and endocytosis tracking to fully characterize Myct1's role in HSC biology.

What are the molecular mechanisms underlying Myct1-mediated regulation of stem cell properties?

The molecular mechanisms through which Myct1 regulates stem cell properties involve:

  • Vesicle trafficking and signaling modulation: Myct1 is localized in the endosomal membrane in HSPCs and interacts with vesicle trafficking regulators and signaling machinery . This localization enables Myct1 to moderate endocytosis rates and signaling responses.

  • Transcriptional program maintenance: Myct1 governs important regulatory programs essential for HSC stemness, including ETS factor expression . This suggests that Myct1 may influence the transcriptional networks that maintain stem cell identity.

  • Metabolic regulation: Myct1 regulation is associated with low mitochondrial activity in HSCs , which aligns with the known metabolic requirements of quiescent stem cells.

  • Culture adaptation: Silencing of Myct1 has been identified as a cell-culture-induced vulnerability that compromises human HSC expansion , suggesting that Myct1 may protect stem cells from environmental stresses.

To investigate these mechanisms, researchers should employ approaches combining proteomics to identify Myct1 interaction partners, live-cell imaging to track endocytosis and signaling dynamics, and functional genomics to map the regulatory networks influenced by Myct1.

What are the most promising research directions for advancing Myct1 understanding?

Several key areas warrant further investigation to advance our understanding of Myct1:

  • Structure-function relationships: Elucidating the structural domains of Myct1 that mediate its interactions with RACK1, Zona Occludens 1, and other partners would provide insights into its molecular mechanisms.

  • Tissue-specific functions: While Myct1's roles in endothelial cells and HSCs are being uncovered, its functions in other cell types where it may be expressed at lower levels remain largely unexplored.

  • Therapeutic development: The promising results of Myct1 targeting in combination with immunotherapy warrant further development of specific Myct1 inhibitors or modulators with clinical potential.

  • Regulatory network mapping: Comprehensive mapping of the upstream regulators and downstream effectors of Myct1 would provide a more complete picture of its biological roles.

  • Translational medicine: Investigating whether MYCT1 expression levels or activity could serve as biomarkers for predicting cancer immunotherapy response or stem cell transplantation outcomes.

What technical challenges should researchers anticipate when working with recombinant Myct1?

Researchers working with recombinant Myct1 should be aware of several technical considerations:

  • Protein solubility and stability: As a membrane-associated protein, recombinant Myct1 may present challenges in terms of solubility and stability during expression and purification.

  • Functional assessment: Given Myct1's multiple cellular roles, developing appropriate functional assays that capture its various activities is essential for meaningful characterization.

  • Cell-type specificity: Myct1's functions appear highly context-dependent, necessitating careful selection of cellular models for in vitro studies.

  • Antibody specificity: Ensuring high specificity of antibodies against Myct1 is crucial, particularly given its relatively low expression levels in many cell types.

  • Physiological relevance: Maintaining physiologically relevant expression levels when overexpressing Myct1 is important to avoid artifacts associated with excessive protein levels.

Addressing these challenges requires interdisciplinary approaches combining structural biology, cell biology, and systems-level analyses to fully capture Myct1's complex biology.

How do the various functions of Myct1 integrate into a cohesive biological role?

The diverse functions of Myct1 across different biological contexts reveal its role as a multifaceted regulator at the intersection of metabolism, translation, cell signaling, and cellular identity:

  • Metabolic-translational interface: Myct1's regulation of glycogen metabolism through translational control mechanisms highlights its role in coupling protein synthesis to metabolic states .

  • Vascular-immune crosstalk: In the tumor microenvironment, Myct1 influences both angiogenesis and immune cell recruitment/function, positioning it as a key mediator of vascular-immune crosstalk .

  • Environmental sensing: Across both endothelial cells and HSCs, Myct1 appears to regulate how cells sense and respond to their environment through cytoskeletal dynamics, endocytosis, and signaling modulation .

  • Cellular identity maintenance: Myct1's role in preserving HSC stemness and its context-dependent expression pattern suggest a function in maintaining specialized cellular identities .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.