Recombinant Mouse Myelin and lymphocyte protein (Mal)

Shipped with Ice Packs
In Stock

Description

Myelin Biogenesis

  • MAL facilitates trafficking of proteolipid protein (PLP) to myelin sheaths. In MAL-deficient mice, disrupted PLP sorting leads to paranodal structural defects .

  • Overexpression alters PLP solubility, impairing lateral diffusion into mature myelin .

Lymphocyte Function

  • Essential for Lck kinase transport to lipid rafts in T-cells. MAL silencing disrupts TCR signaling and exosome secretion .

  • Upregulated in aggressive lymphomas (e.g., 70% of primary mediastinal B-cell lymphomas) , suggesting a role in oncogenic signaling.

Pathogen Interactions

  • Serves as a receptor for Clostridium perfringens ε-toxin (ETX). Recombinant MAL expression in CHO cells confers ETX sensitivity, with species-specific efficacy (rat MAL > human MAL) .

  • ETX binding requires an intact second extracellular loop; FLAG-tag insertion abolishes toxicity .

Research Applications

Recombinant mouse MAL is pivotal for:

  • Mechanistic studies: Elucidating MAL’s dual role in cancer (tumor suppressor in epithelial cancers vs. oncogene in lymphomas) .

  • Therapeutic targeting: Screening compounds that modulate MAL-ETX interactions .

  • Disease modeling: Studying dysmyelination in MAL-deficient systems .

Challenges and Future Directions

  • Species-specific variability: Rat MAL shows higher ETX affinity than human MAL, underscoring the need for mouse-specific studies .

  • Structural insights: Cryo-EM data for MAL homologs (e.g., synaptophysin) suggest hexameric channel-like structures , but mouse MAL’s 3D conformation remains unresolved.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we can accommodate specific format requests. Please specify your desired format in the order notes, and we will do our best to fulfill your requirements.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All protein orders are shipped with standard blue ice packs. If dry ice shipping is preferred, please inform us in advance as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability. Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Mal; Myelin and lymphocyte protein; T-lymphocyte maturation-associated protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-153
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Mal
Target Protein Sequence
MAPAAASGGSTLPSGFSVFTTFPDLLFVCEFVFGGLVWILIASSLVPLPLAQGWVMFVSV FCFVATTSLMILYIIGTHGGETSWITLDAAYHCVAALFYLSASVLEALATISMFDGFTYK HYHENIAAVVFAYVVTLIYVVHAVFSLIRWKSS
Uniprot No.

Target Background

Function
Myelin and lymphocyte protein (MAL) plays a crucial role in vesicular trafficking, cycling between the Golgi complex and the apical plasma membrane. It is involved in the maintenance of the myelin sheath and facilitates interactions between axons, glial cells, and other glia.
Gene References Into Functions
  1. Expression of the developmentally regulated proteolipid MAL is essential for the cytotoxic effect of Clostridium perfringens Epsilon Toxin. PMID: 26081637
  2. MAL overexpression leads to reduced expression of Mpz and p75NTR, despite functional pathways and normal expression of genes critical for Schwann cell differentiation. PMID: 25290060
  3. VIP17/MAL overexpression results in abnormal cilium and cyst development, both in vitro and in vivo, and in VIP17/MAL-overexpressing mice that develop cysts secondary to a ciliary defect. PMID: 22895261
  4. The exclusion of MAL from the expanding 2D crystals of uroplakins explains the selective association of MAL with the hinge areas in the uroplakin-delivering fusiform vesicles, as well as at the apical surface PMID: 22323295
  5. Phagosomal retention of Francisella tularensis results in TIRAP/Mal-independent TLR2 signaling. PMID: 19889726
  6. The specific reduction and mistargeting of MAL protein as a reaction to sulfatide overload may contribute to the pathogenic mechanisms in metachromatic leukodystrophy. PMID: 15193296
  7. Our research highlights a critical role for MAL in the maintenance of central nervous system paranodes, likely by regulating the trafficking and/or sorting of NF155 and other membrane components in oligodendrocytes. PMID: 15337780
  8. Our findings suggest a functional role for MAL in peripheral myelination by influencing the expression of membrane components that mediate axon-glia interaction during ensheathment and myelin wrapping. PMID: 19508690

Show More

Hide All

Database Links

KEGG: mmu:17153

UniGene: Mm.39040

Protein Families
MAL family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein. Apical cell membrane; Multi-pass membrane protein. Note=Found in lipid raft.
Tissue Specificity
Expressed in the spinal cord, brain, kidney and gastrointestinal tract especially in the stomach and caecum. Highly expressed by myelinating glial cells.

Q&A

What is mouse MAL protein and what are its structural characteristics?

Mouse Myelin and Lymphocyte protein (MAL) is a 17-kDa protein containing four putative transmembrane segments. The full-length mouse MAL protein consists of 153 amino acids (1-153aa) and shares significant sequence homology with the human version. MAL belongs to the MARVEL (MAL and related proteins for vesicle formation and membrane link) domain superfamily, which is conserved across species. The protein has unusual biochemical properties that qualify it as a proteolipid protein, with lipid-like characteristics that facilitate its integration into specialized membrane structures .

Where is MAL protein expressed and what are its primary functions?

MAL protein expression is restricted to specific cell types including T lymphocytes, polarized epithelial cells, and myelin-forming cells such as oligodendrocytes. In these cellular contexts, MAL functions as an organizer of specialized condensed membranes, playing crucial roles in membrane trafficking and the organization of membrane microdomains. In myelin-forming cells specifically, MAL regulates the distribution of myelin proteins such as Proteolipid Protein (PLP) into distinct membrane microdomains, influencing myelin membrane formation and function .

What expression systems are optimal for producing recombinant mouse MAL protein?

Based on the available research data, recombinant mouse MAL protein can be successfully expressed in E. coli expression systems. For optimal results when producing membrane proteins like MAL, specialized E. coli strains may be beneficial. While not specific to mouse MAL, research on related myelin proteins suggests that SHuffle cells, a commercially available E. coli strain engineered to facilitate disulfide bond formation in the cytoplasm, can be highly effective for producing soluble recombinant myelin proteins . Since MAL contains multiple transmembrane domains, expression systems designed for membrane proteins would be advantageous.

What purification strategies yield highest purity recombinant mouse MAL protein?

For efficient purification of recombinant mouse MAL protein, affinity chromatography using N-terminal His-tags is an effective approach. The purification protocol should account for MAL's lipid-like properties and tendency to associate with membranes. For researchers aiming to achieve greater than 90% purity (as determined by SDS-PAGE), a multi-step purification process is recommended:

  • Initial affinity chromatography using His-tag binding

  • Size exclusion chromatography to separate monomeric protein

  • Optional ion exchange chromatography for removing remaining contaminants

The final product is typically prepared in a Tris/PBS-based buffer (pH 8.0) containing 6% trehalose to enhance stability during storage .

How can researchers optimize recombinant MAL protein solubility and stability?

To optimize solubility and stability of recombinant mouse MAL protein:

  • Express the protein in specialized E. coli strains designed for membrane proteins or proteins requiring disulfide bond formation (such as SHuffle cells)

  • Include stabilizing agents such as trehalose (6%) in storage buffers

  • Maintain an optimal pH range (around 8.0) in buffer solutions

  • After reconstitution in deionized sterile water to 0.1-1.0 mg/mL, add glycerol to a final concentration of 30-50% for long-term storage

  • Store working aliquots at 4°C for up to one week to avoid repeated freeze-thaw cycles

  • For long-term storage, keep at -20°C/-80°C in aliquoted format

How does MAL protein interact with membrane microdomains in myelin-forming cells?

MAL protein demonstrates a high affinity for condensed membrane domains and selectively partitions into detergent-resistant membranes (DRMs). This selective association with DRMs appears to be a genuine feature related to MAL's capacity to interact with compact lipid environments. In myelin-forming cells:

  • MAL associates with lipid rafts or ordered membrane domains

  • It has an affinity for condensed membranes greater than many other transmembrane proteins

  • It partitions into condensed domains in giant plasma membrane vesicles with an affinity similar to prototypical raft markers

  • The interaction with these specialized membrane domains is crucial for MAL's function in organizing membrane microdomains

Advanced in vitro analysis using cell-derived giant plasma membrane vesicles has confirmed MAL's high affinity for ordered lipid phases, with partitioning similar to that of glycosylphosphatidylinositol (GPI)-anchored proteins and cholera toxin (which binds GM1 ganglioside) .

What methodologies are effective for studying MAL's role in PLP trafficking and myelin formation?

To study MAL's role in PLP trafficking and myelin formation, researchers can employ these methodological approaches:

  • Expression Systems: Use mCherry-MAL constructs for visualization in oligodendrocyte progenitor cells

  • Detergent Extraction Analysis: Compare PLP distribution in TX-100-insoluble membrane domains versus CHAPS-resistant but TX-100-soluble membrane domains

  • Confocal Microscopy: Visualize trafficking of fluorescently tagged PLP in the presence or absence of MAL expression

  • Conformation-Sensitive Antibodies: Use antibodies that recognize specific conformations of PLP to assess surface expression profiles

  • In vivo Validation: Compare in vitro findings with membrane microdomain shifts in developing brain

These techniques have revealed that MAL regulates PLP's distribution into distinct membrane microdomains rather than affecting vesicular trafficking directly. This regulation allows for lateral diffusion of PLP from the plasma membrane to the myelin membrane once the myelin sheath has been assembled .

What experimental controls should be included when investigating MAL function in oligodendrocytes?

When investigating MAL function in oligodendrocytes, the following experimental controls should be included:

  • Timing Controls: Since premature expression of MAL in oligodendrocyte progenitor cells can interfere with terminal differentiation, time-course experiments with appropriate controls at each time point

  • Expression Level Controls: Cells with various levels of MAL expression to account for dose-dependent effects

  • Detergent Extraction Controls: Multiple detergent types (TX-100 and CHAPS) to distinguish between different membrane microdomain populations

  • Membrane Formation Controls: Assessments of myelin membrane formation independent of MAL expression

  • Trafficking Controls: Markers for vesicular transport pathways to distinguish between trafficking defects and membrane domain redistribution effects

These controls are essential because MAL's effects on oligodendrocyte differentiation and PLP distribution are highly dependent on the timing of expression and the specific membrane domains being examined.

How do functional differences between recombinant and native MAL protein impact experimental interpretation?

Researchers should be aware of several factors that may cause functional differences between recombinant and native MAL protein:

  • Post-translational Modifications: Recombinant MAL produced in E. coli lacks eukaryotic post-translational modifications that may be present in native protein

  • Protein Folding: The four transmembrane segments of MAL require proper folding for function, which may differ between recombinant and native forms

  • Membrane Integration: Recombinant MAL may integrate differently into membranes compared to native protein

  • Protein-Protein Interactions: Fusion tags (like His) may interfere with some protein-protein interactions

  • Lipid Interactions: The proteolipid properties of MAL make it particularly sensitive to its lipid environment, which differs between recombinant and native contexts

To address these limitations, researchers should validate findings from recombinant protein studies with complementary approaches using native protein or cellular expression systems .

What are the most effective methods for assessing MAL protein interactions with other myelin components?

For assessing MAL protein interactions with other myelin components, researchers should consider these methodological approaches:

  • Co-immunoprecipitation: To identify direct protein-protein interactions

  • Detergent Resistance Analysis: Comparing the distribution of MAL and interacting proteins in different membrane fractions

  • Fluorescence Resonance Energy Transfer (FRET): For assessing proximity of MAL to other myelin proteins in living cells

  • Protein Complementation Assays: To visualize protein interactions in cellular contexts

  • Analytical Size Exclusion Chromatography: Combined with multi-angle light scattering (SEC-MALS) to characterize protein complexes

  • Cross-linking Mass Spectrometry: To identify interaction interfaces at the molecular level

These techniques can help elucidate how MAL interacts with other myelin components such as PLP and how it influences their distribution and function in membranes .

How can researchers differentiate between direct effects of MAL on membrane microdomains versus indirect effects on protein trafficking?

To differentiate between direct effects of MAL on membrane microdomains versus indirect effects on protein trafficking, researchers can implement these experimental strategies:

  • Domain Mutant Analysis: Create MAL mutants with alterations in specific transmembrane domains to identify regions responsible for microdomain organization versus trafficking functions

  • Temporally Controlled Expression: Use inducible expression systems to introduce MAL at different stages of oligodendrocyte differentiation

  • Membrane Fractionation: Combine detergent extraction with density gradient centrifugation to separate different membrane populations

  • Live Cell Imaging: Track fluorescently labeled proteins in real-time to distinguish between trafficking defects and redistribution within the membrane

  • Biophysical Membrane Analysis: Use techniques like fluorescence recovery after photobleaching (FRAP) to measure protein mobility within membranes

Research has shown that MAL appears to regulate PLP's distribution into distinct membrane microdomains rather than affecting vesicular trafficking directly. This regulation allows for lateral diffusion of PLP from the plasma membrane to the myelin membrane once the myelin sheath has been assembled .

What are common challenges in expressing full-length mouse MAL protein and how can they be addressed?

Common challenges in expressing full-length mouse MAL protein include:

ChallengeSolution
Protein insolubilityUse specialized E. coli strains (e.g., SHuffle cells) engineered to facilitate proper folding of complex proteins
Low expression yieldOptimize codon usage for E. coli expression and use strong inducible promoters
Protein degradationInclude protease inhibitors during purification and optimize extraction conditions
Improper foldingConsider expression at lower temperatures (16-25°C) to allow proper folding
AggregationInclude stabilizing agents like trehalose in purification buffers
Difficulty in membrane integrationUse detergent micelles or lipid nanodiscs to provide suitable hydrophobic environment

While not specific to mouse MAL, experience with other myelin proteins suggests that SHuffle cells can significantly improve the yield of soluble protein, producing >100 mg/L for some myelin proteins .

How can researchers verify the proper folding and functionality of recombinant mouse MAL protein?

To verify proper folding and functionality of recombinant mouse MAL protein, researchers should employ multiple complementary techniques:

  • Analytical Size Exclusion Chromatography: Combined with multi-angle light scattering (SEC-MALS) to assess protein homogeneity and oligomeric state

  • Differential Scanning Fluorimetry: To determine melting temperature, which can indicate stability and proper folding

  • Circular Dichroism Spectroscopy: To analyze secondary structure content, particularly important for transmembrane proteins

  • Functional Assays: Testing the ability of MAL to partition into detergent-resistant membrane fractions

  • Membrane Integration Assays: Assessing incorporation into artificial membranes or liposomes

  • Protein-Protein Interaction Analysis: Verifying interactions with known binding partners

These techniques, particularly SEC-MALS and differential scanning fluorimetry, have proven valuable in determining whether recombinant myelin proteins are well-folded and functional .

What are the advantages and limitations of different tags for purifying recombinant mouse MAL protein?

Different tags for purifying recombinant mouse MAL protein offer various advantages and limitations:

TagAdvantagesLimitationsBest Applications
His-tag- Simple one-step purification
- Small size (6-10 residues)
- Minimal impact on structure
- Compatible with denaturing conditions
- Some nonspecific binding
- May not be accessible in all protein conformations
- Potential metal ion leaching
General purification and initial characterization
GST-tag- Enhanced solubility
- Mild elution conditions
- Can be used as marker for expression
- Large size may affect function
- Potential for dimerization
- May require tag removal
Improving solubility of membrane proteins
MBP-tag- Significantly enhances solubility
- Can be used with difficult-to-express proteins
- Large size (42 kDa)
- May interfere with membrane integration
- Often requires tag removal
Enhancing solubility of problematic proteins
FLAG-tag- High specificity
- Good for detection
- Small size
- More expensive resins
- Lower binding capacity
Sensitive detection and cleaner purification

For mouse MAL protein, the His-tag appears to be a commonly used and effective option, particularly when positioned at the N-terminus to avoid interference with membrane integration of the transmembrane domains .

How does MAL function in oligodendrocytes compare to its role in T cells and epithelial cells?

MAL functions across different cell types show both commonalities and unique aspects:

Cell TypeMAL LocalizationMAL FunctionUnique Features
OligodendrocytesMyelin membrane and compact membrane domainsRegulates PLP distribution in membrane microdomains for myelin formationInfluences lateral diffusion of myelin proteins during myelination
T CellsSpecialized membrane domainsInvolved in T cell maturation and signal transductionContributes to immunological synapse formation
Epithelial CellsApical membrane and transport vesiclesRegulates polarized membrane traffickingFunctions in membrane-protein sorting machinery

While MAL serves as an organizer of specialized condensed membranes across all these cell types, its specific interaction partners and precise mechanisms differ. In oligodendrocytes, MAL particularly influences the distribution of myelin proteins like PLP into distinct membrane microdomains that facilitate myelin sheath assembly .

What research questions about MAL remain unresolved that could benefit from recombinant protein approaches?

Several unresolved questions about MAL could benefit from recombinant protein approaches:

  • Structure-Function Relationships: Which domains of MAL are specifically responsible for its membrane organizing capabilities versus its protein interaction functions?

  • Lipid Interactions: How does MAL specifically interact with different lipid species to organize membrane domains?

  • Molecular Mechanism: What is the precise molecular mechanism by which MAL regulates the distribution of proteins like PLP into specific membrane microdomains?

  • Post-translational Modifications: How do modifications of MAL protein affect its function in different cellular contexts?

  • Interaction Network: What is the complete interactome of MAL in myelin-forming cells?

  • Temporal Regulation: How is MAL expression and function precisely regulated during oligodendrocyte differentiation and myelination?

Addressing these questions would require carefully designed experiments using both recombinant proteins and cellular models .

How can techniques developed for recombinant MOG production be adapted for optimizing mouse MAL protein expression?

Techniques developed for recombinant MOG production can be adapted for optimizing mouse MAL protein expression in several ways:

  • Use of SHuffle Cells: The SHuffle E. coli strain that has proven successful for rhMOG production could be adapted for MAL expression, as it facilitates disulfide bond formation in the cytoplasm and can produce soluble protein with yields >100 mg/L

  • Expression Optimization: Parameters optimized for rhMOG (induction conditions, temperature, media composition) could be modified for MAL production

  • Purification Strategy: The multi-step purification process involving initial capture by affinity chromatography followed by polishing steps can be adapted

  • Quality Control Methods: Analytical techniques such as SEC-MALS and differential scanning fluorimetry used to assess rhMOG quality could be applied to MAL

  • Folding Analysis: Methods to verify proper protein folding, critically important for transmembrane proteins like MAL, can be adapted from the rhMOG protocol

These adaptations would need to account for the differences between MOG and MAL, particularly MAL's four transmembrane domains compared to MOG's single transmembrane segment .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.