Recombinant Mouse Myelin-oligodendrocyte glycoprotein (Mog)

Shipped with Ice Packs
In Stock

Description

Introduction

Myelin oligodendrocyte glycoprotein (MOG) is a crucial component of the central nervous system (CNS), specifically expressed on the outermost surface of myelin sheaths and oligodendrocyte membranes . As a member of the immunoglobulin (Ig) superfamily, MOG is a key target in autoimmune responses related to inflammatory demyelinating diseases . Recombinant Mouse MOG is produced using genetic engineering techniques to create a pure and consistent form of the protein, which is essential for research and diagnostic applications .

Characteristics and Structure

MOG is a minor myelin component comprising 245 amino acids with a molecular weight of 26–28 kDa . It exists only in mammals and is highly conserved across different species . The protein is a Type 1 integral membrane glycoprotein . The gene for human MOG is located on chromosome 6 within the human leukocyte antigen (HLA) gene locus, while in mice, it is on chromosome 17 within the major histocompatibility complex (MHC) gene locus .

Recombinant Mouse MOG, expressed from HEK293 cells, includes a His tag at the C-terminus and contains Gly29-Thr156 amino acids . The predicted molecular weight is 15.68 kDa, but due to glycosylation, it migrates to 18-25 kDa on Bis-Tris PAGE gels .

Production and Quality Control

PropertyDescription
Expression SystemHEK293
Amino Acid RangeGly29-Thr156
Molecular WeightPredicted 15.68 kDa, migrates to 18-25 kDa due to glycosylation
Purity>95% as determined by Bis-Tris PAGE
Endotoxin LevelLess than 1 EU per μg by the LAL method
TagC-His
FormulationLyophilized from 0.22 μm filtered solution in PBS (pH 7.4) with 8% trehalose as protectant
ReconstitutionRecommended concentration >100 μg/mL in distilled water
Stability & Storage-20 to -80°C for 12 months as supplied; -80°C for 3 months after reconstitution; minimize freeze-thaw cycles

Function and Biological Role

The precise function of MOG is still under investigation, but it is believed to function as a cell surface receptor or cell adhesion molecule . It may also play a role in myelin compaction or stabilization of microtubules . MOG interacts with several molecules, including C1q, nerve growth factor, and DC-SIGN . It has been implicated as a cellular receptor for the rubella virus .

MOG in Autoimmune Diseases

MOG is a significant autoantigen in experimental autoimmune encephalomyelitis (EAE), an animal model for multiple sclerosis (MS) . Antibodies against MOG (MOG-IgG) are associated with acquired inflammatory demyelinating diseases, such as MOG antibody-associated disease (MOGAD), which frequently presents with optic neuritis (ON) .

5.1. Pathogenicity of MOG Antibodies

MOG antibodies can directly affect oligodendrocytes, leading to changes in the cytoskeleton, repartitioning of MOG into lipid rafts, and altered phosphorylation patterns of various proteins . Pathogenic anti-MOG antibodies bind to the surface of oligodendrocytes, inducing membrane protein redistribution and changes in cell morphology .

In studies using recombinant MOG, it has been found that only pathogenic antibodies bind to glycosylated MOG, which is the form most likely present on the surface of oligodendrocytes and myelin . These antibodies can induce the repartitioning of MOG into detergent-insoluble fractions, consistent with lipid rafts, and cause retraction of oligodendrocyte processes .

5.2. Experimental Autoimmune Encephalomyelitis (EAE)

Immunization with MOG can induce EAE in various animal models . The pathogenicity of MOG antibodies in EAE depends on their ability to recognize specific antigenic determinants . For example, the presence of proline at position 42 in human MOG is critical for inducing a B cell-dependent EAE .

Clinical Significance

MOG antibodies are detected in patients with multiple sclerosis, neuromyelitis optica spectrum disorder (NMOSD), and MOGAD . MOGAD is characterized by the presence of MOG-IgG autoantibodies, which target MOG on the surface of oligodendrocytes and myelin sheaths .

Research Applications

Recombinant Mouse MOG is utilized in diverse research applications:

  • Antibody Discovery: As an antigen for generating and screening MOG-specific antibodies .

  • EAE Models: For inducing and studying EAE in mice to understand the pathogenesis of demyelinating diseases .

  • In Vitro Studies: To investigate the direct effects of MOG antibodies on oligodendrocytes and myelin .

  • Diagnostic Assays: As a reagent in assays to detect and quantify MOG antibodies in patient samples .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life is influenced by storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Mog; Myelin-oligodendrocyte glycoprotein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
29-246
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Mog
Target Protein Sequence
GQFRVIGPGYPIRALVGDEAELPCRISPGKNATGMEVGWYRSPFSRVVHLYRNGKDQDAE QAPEYRGRTELLKETISEGKVTLRIQNVRFSDEGGYTCFFRDHSYQEEAAMELKVEDPFY WVNPGVLTLIALVPTILLQVPVGLVFLFLQHRLRGKLRAEVENLHRTFDPHFLRVPCWKI TLFVIVPVLGPLVALIICYNWLHRRLAGQFLEELRNPF
Uniprot No.

Target Background

Function
Myelin-oligodendrocyte glycoprotein (MOG) is a minor component of the myelin sheath. It is believed to be involved in myelin sheath formation and maintenance, as well as cell-cell communication. MOG mediates homophilic cell-cell adhesion.
Gene References Into Functions

Research Highlights on Myelin Oligodendrocyte Glycoprotein (MOG):

  1. Conformational characteristics of the rat/mouse MOG35-55 immunodominant epitope were explored to inform the rational design of altered peptide ligands or non-peptide mimetics as potential inhibitors of experimental autoimmune encephalomyelitis (EAE). PMID: 27483998
  2. NGF was identified as a MOG binding partner, demonstrating its capacity to sequester NGF from TrkA-expressing neurons, thereby modulating axon growth and survival. PMID: 26347141
  3. The absence of N-glycans did not affect MOG subcellular localization or induce endoplasmic reticulum stress. PMID: 25541284
  4. In mixed bone marrow chimeras expressing MOG, the development of MOG-specific B cells was abrogated. PMID: 24532581
  5. Variations in biosynthetic MOG35-55 peptide concentration induced different optic neuritis profiles in animal models. PMID: 24083391
  6. Immunogenic/encephalitogenic T-cell epitopes within MOG capable of inducing EAE in C57BL/6 mice were identified. PMID: 23876060
  7. PLP significantly suppressed EAE models, even with epitope spreading in the MOG38-50-induced EAE model. PMID: 23911075
  8. CNTF may contribute to remyelination by inducing MOG expression. PMID: 23443463
  9. MOG-specific CD4-positive T cells accumulated in chemokine-expressing draining lymph nodes during EAE induction, not in the CNS. PMID: 22287719
  10. Anti-myelin oligodendrocyte glycoprotein reactivity criteria for prognostic biomarker status in a MS subtype were established. PMID: 22093619
  11. Mice immunized with MOG(35-55) developed significant anti-MOG antibody serum levels correlating with disease progression. PMID: 21993076
  12. B cell deficiency reduced medullary thymic epithelial cell numbers and MOG mRNA expression. PMID: 21550671
  13. The absence of endoplasmic reticulum chaperones did not disrupt MOG cell surface targeting. PMID: 21172390
  14. MOG self-tolerance modulated the encephalitogenic potential of autoreactive MOG T cells. PMID: 14624757
  15. Citrullination at residues Arg41 and Arg46 in the immunodominant 35-55 peptide (pMOG) expanded the repertoire of T cells contributing to encephalomyelitis. PMID: 20164413
  16. Lack of systemic complement delayed EAE onset and attenuated disease severity by reducing MOG-specific T cell responses and autoantibody production. PMID: 19201476
  17. The encephalitogenic peptide MOG(35-55) required class II-restricted antigen processing in the CNS to initiate autoimmune demyelination. PMID: 11937578
  18. MOG is implicated in spontaneous autoimmune optic neuritis. PMID: 12732654
  19. MOG plays a role in immune tolerance and experimental autoimmune encephalomyelitis. PMID: 12925695
  20. Anti-MOG treatment of oligodendrocytes increased calcium influx and activated MAPK/Akt pathways. PMID: 15634682
  21. Opticospinal encephalomyelitis mice B cells bound high dilutions of recombinant MOG (but not MOG peptide), processing and presenting it to autologous T cells. PMID: 16955140
  22. Ig heavy chainMOG mice spontaneously developed severe EAE. PMID: 16955141
  23. Prevention of EAE by ES-DC-TRAIL/MOG involved MOG-reactive CD4(+)CD25(+) Treg propagated by ES-DC-TRAIL/MOG. PMID: 17202353
  24. RR mice with a TCR specific for MOG peptide 92-106 were described. PMID: 19487416
  25. MOG37-46-reactive CD8+ T cells were pro-inflammatory and trafficked to the CNS; however, CD4+ T cells elicited more severe, sustained CNS inflammation. PMID: 19540601
  26. CEACAM1 ligation negatively regulated EAE severity by reducing MOG(35-55)-specific interferon-gamma and interleukin-17 induction via iNKT cell-dependent mechanisms. PMID: 19700760
  27. MOG protein localization signal. PMID: 11389181
Database Links
Protein Families
Immunoglobulin superfamily, BTN/MOG family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Found exclusively in the CNS, where it is localized on the surface of myelin and oligodendrocyte cytoplasmic membranes. Reduced expression levels are observed in jimpy and quacking dysmyelinating mutant mice.

Q&A

What is Recombinant Mouse Myelin-oligodendrocyte Glycoprotein (MOG)?

Recombinant Mouse MOG is a laboratory-produced version of the naturally occurring MOG protein found in mice. MOG is a 28 kDa single-pass transmembrane glycoprotein that belongs to the immunoglobulin (Ig) superfamily. The native mouse MOG protein consists of a 28 amino acid signal sequence, a 128 amino acid extracellular domain (ECD) containing an Ig-like domain, a 21 amino acid transmembrane domain, and a 69 amino acid cytosolic fragment .

MOG is expressed exclusively by oligodendrocytes in the central nervous system (CNS) and is localized to the outer layer of the myelin sheath and in the oligodendrocyte plasma membrane. It functions as an adhesion molecule and mediator of immune activation in the CNS .

How does MOG function in the central nervous system?

MOG is located on the outermost lamellae of the myelin sheath, making it accessible to antibody-mediated attack . Its expression in the brain can serve as a temporal biomarker for myelin development . While its exact physiological function remains under investigation, MOG is thought to function as an adhesion molecule as well as a mediator of immune activation in the CNS . The protein's structural features, including its Ig-like domain, contribute to its ability to form dimers at the cell surface, which may be important for its normal function .

What is the structural composition of recombinant MOG?

The crystal structure of MOG extracellular domain (MOGED) has been determined at 1.8 Å resolution . The structure reveals an immunoglobulin (Ig)-like fold typical of the Ig superfamily. Detailed crystallographic data shows:

Data Collection ParameterValue
Temperature (K)100
Space groupI4 1
Cell dimensions, Å (a, b, c)65.7, 65.7, 67.6
Resolution (Å)1.8
Total observations33,022
Unique observations13,229
Data completeness (%)99.0 (100.0)
R merge (%)6.5 (24.6)

The final refined model comprises residues 2-117, 215 water molecules, and two sulfate ions, with an R factor of 20.1% and an R free of 23.7% .

How is recombinant MOG used in multiple sclerosis research?

Recombinant MOG is primarily used to induce experimental autoimmune encephalomyelitis (EAE), an animal model for multiple sclerosis (MS) and related CNS demyelinating diseases such as MOG antibody-associated disease (MOGAD) . In vivo administration of exogenous MOG protein or peptide induces EAE in multiple animal species .

The MOG-induced EAE model is particularly valuable because it can produce different forms of the disease depending on the preparation:

  • MOG peptide 35-55 induces primarily T cell-mediated EAE in C57BL/6 mice

  • Full-length human MOG induces B cell-dependent EAE with demyelinating antibodies

  • Different mouse strains recognize different MOG epitopes, allowing for varied experimental approaches

These models enable researchers to study disease mechanisms, test therapeutic interventions, and investigate both cellular and humoral aspects of autoimmune demyelination.

What are the critical differences between human and mouse MOG proteins?

Despite 90% amino acid sequence identity in their extracellular domains , human and mouse MOG proteins exhibit important functional differences in experimental settings:

  • Immunization with human MOG in C57BL/6 mice produces B cell-dependent EAE, while rodent MOG typically produces B cell-independent disease

  • Antibodies against human MOG can bind to glycosylated MOG in myelin and to live oligodendrocytes, whereas antibodies against rat MOG bind poorly to native MOG in myelin

  • Pathogenic antibodies generated by immunization with human MOG can induce dramatic changes in oligodendrocyte morphology when cross-linked, while antibodies to rat MOG lack this property

These differences highlight the importance of carefully selecting the appropriate MOG species for specific research questions, particularly when studying B cell contributions to disease.

How do post-translational modifications affect MOG's encephalitogenic properties?

Post-translational modifications, particularly glycosylation, significantly affect MOG's encephalitogenic properties. Research findings indicate:

  • Pathogenic anti-MOG antibodies bind specifically to glycosylated MOG, whereas non-pathogenic antibodies bind to both glycosylated and deglycosylated forms

  • Only antibodies that recognize properly glycosylated MOG can bind to live oligodendrocytes and induce pathogenic effects

  • Enzymatic deglycosylation of MOG in myelin allows binding of normally non-pathogenic antibodies

  • Western blot analysis shows that pathogenic antibodies recognize glycosylated MOG at approximately 25 kDa, while exhibiting different binding patterns to recombinant and deglycosylated MOG

When producing recombinant MOG for research, the preservation of proper glycosylation may be critical for generating physiologically relevant antibody responses, especially for B cell-dependent EAE models.

What are the optimal methods for inducing EAE with recombinant MOG?

The optimal methods for inducing EAE with recombinant MOG vary depending on the research question:

  • For T cell-mediated EAE:

    • MOG peptide 35-55 (25 mg) is commonly used in C57BL/6 mice

    • Complete Freund's adjuvant supplemented with Mycobacterium tuberculosis

    • Pertussis toxin administration on days 0 and 2

  • For B cell-dependent EAE:

    • Full-length human MOG extracellular domain (typically amino acids 1-125)

    • Expression in systems that maintain proper protein folding and glycosylation

    • C57BL/6 mice are commonly used for this model

  • For studies in SJL mice:

    • Truncated human recombinant MOG (amino acids 1-120) expressed in insect cells

    • This induces immune responses to the 1-30 and 81-110 regions

Recent advances in production methods have addressed previous limitations related to protein insolubility, allowing for more consistent and reproducible EAE induction .

How do anti-MOG antibodies induce demyelination at the molecular level?

Anti-MOG antibodies induce demyelination through several molecular mechanisms revealed through in vitro studies with cultured oligodendrocytes:

  • When anti-MOG antibodies bind to MOG on oligodendrocyte surfaces and are cross-linked by secondary antibodies, MOG rapidly repartitions into detergent-insoluble microdomains characteristic of lipid rafts

  • This repartitioning triggers changes in the phosphorylation status of at least 10 different proteins in oligodendrocytes

  • These signaling changes culminate in dramatic alterations to oligodendrocyte cytoarchitecture, including retraction of oligodendrocyte processes that correlates with cytoskeletal destabilization

  • The morphological changes likely compromise the oligodendrocyte's ability to maintain the myelin sheath, leading to demyelination

This molecular pathway provides a mechanistic link between antibody binding and demyelination observed in vivo, offering potential targets for therapeutic intervention in antibody-mediated demyelinating diseases.

What are the different epitopes of MOG recognized across mouse strains?

Different mouse strains recognize distinct epitopes of the MOG protein, which has important implications for experimental design:

Mouse StrainPrimary EpitopesResponse Characteristics
C57BL/6 (H-2b)MOG 35-55Strong T cell response, B cell contribution depends on MOG source
SJL (H-2s)MOG 1-30, MOG 81-110Both regions recognized after immunization with rhMOG 1-120
(PLJ X SJL)F1Similar to SJLResponsive to truncated human MOG

In SJL mice, intravenous administration of MOG 91-110 peptide can effectively treat EAE induced by truncated human MOG, suggesting the therapeutic potential of epitope-specific tolerance induction .

The encephalitogenic B cell epitopes on human MOG recognized by C57BL/6 mice are distributed across multiple regions rather than concentrated in one specific area .

How can recombinant MOG preparations be optimized for specific research questions?

Optimizing recombinant MOG preparations depends on the specific research focus:

  • For studying T cell mechanisms:

    • Synthetic MOG peptides (e.g., MOG 35-55) at high purity

    • May not require glycosylation or native conformation

  • For studying B cell contributions and demyelinating antibodies:

    • Full extracellular domain of human MOG with proper folding

    • Expression systems that maintain glycosylation (insect cells, mammalian cells)

    • Carrier-free formulations may be preferred for certain applications

  • For protein stability:

    • Lyophilized MOG can be reconstituted at specific concentrations (e.g., 100 μg/mL) in PBS

    • Avoid repeated freeze-thaw cycles and use a manual defrost freezer

  • For advanced immunological studies:

    • Site-directed mutagenesis of specific residues (e.g., P42S) can alter pathogenicity

    • Deglycosylated variants can be used to study the role of glycosylation

Recent advances in production methods have improved yield and solubility of recombinant human MOG, potentially offering better options for researchers .

How can researchers differentiate between pathogenic and non-pathogenic anti-MOG antibodies?

Differentiating between pathogenic and non-pathogenic anti-MOG antibodies is crucial for understanding disease mechanisms. Research indicates several methodological approaches:

  • Binding to live oligodendrocytes:

    • Pathogenic antibodies bind to MOG on live cultured oligodendrocytes

    • Non-pathogenic antibodies typically fail to bind or bind weakly

  • Effect on oligodendrocyte morphology:

    • When cross-linked, pathogenic antibodies induce dramatic changes in oligodendrocyte morphology

    • Non-pathogenic antibodies do not induce these changes

  • Western blot analysis:

    • Pathogenic antibodies bind strongly to glycosylated MOG in myelin

    • Non-pathogenic antibodies may bind to recombinant or deglycosylated MOG but bind poorly to native glycosylated MOG

  • In vivo transfer:

    • Pathogenic antibodies exacerbate EAE when transferred to B cell-deficient mice primed with MOG

    • Non-pathogenic antibodies have minimal or no effect in this model

These assays provide reliable methods to assess the pathogenic potential of anti-MOG antibodies, which is critical for evaluating therapeutic approaches targeting the humoral immune response in demyelinating diseases.

How can MOG-induced models inform therapeutic strategies for MS and MOGAD?

MOG-induced EAE models have revealed several promising therapeutic strategies:

  • Epitope-specific tolerance induction:

    • Intravenous administration of MOG 91-110 peptide effectively treats EAE in SJL mice immunized with truncated human MOG

    • This approach supports the potential for antigen-dependent treatments in MS

  • Modulation of T cell differentiation:

    • ATRA-containing liposomal adjuvants can transdifferentiate Th17 cells to a Tr1-like phenotype

    • This approach may reduce pathogenic T cell responses while promoting regulatory mechanisms

  • Targeting pathogenic antibody functions:

    • Understanding how antibodies induce MOG redistribution into lipid rafts provides potential targets for intervention

    • Disrupting the signaling pathways activated by antibody binding could prevent demyelination

  • B cell-targeted therapies:

    • The B cell-dependent human MOG EAE model is valuable for testing B cell-depleting or modulating therapies

These findings support developing antigen-specific approaches for treating MS and MOGAD, potentially offering more selective immunomodulation with fewer side effects than current broad-spectrum therapies.

How do variations in MOG sequences across species affect translational research?

Sequence variations in MOG across species have important implications for translational research:

  • Antibody cross-reactivity:

    • Human MOG-specific antibodies may recognize different epitopes than those recognized by antibodies against rodent MOG

    • This affects the interpretation of animal studies when translating to human disease

  • T cell epitope recognition:

    • The 90% sequence identity between human and mouse MOG extracellular domains still allows for species-specific differences in T cell recognition

    • These differences may influence immunogenicity and therapeutic responses

  • Model selection:

    • Human MOG-induced EAE in C57BL/6 mice provides a more translational model for studying MOG antibody-associated diseases in humans

    • This model better recapitulates the B cell and antibody contribution seen in many MS patients and in MOGAD

  • Therapeutic development:

    • Therapies developed against specific MOG epitopes need to account for species differences

    • Humanized mouse models expressing human MOG may offer advantages for certain therapeutic approaches

Understanding these cross-species differences is essential for properly interpreting experimental results and designing translational studies with potential clinical applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.