Recombinant Mouse Myeloid-associated differentiation marker-like protein 2 (Myadml2)

Shipped with Ice Packs
In Stock

Description

Introduction to Myadml2

Myadml2 belongs to the myeloid-associated differentiation marker protein family, which was initially identified in hematopoietic progenitor cells but has since been recognized in various tissues. The name "myeloid-associated differentiation marker-like protein 2" indicates its structural and possibly functional similarity to the better-characterized myeloid-associated differentiation marker (MYADM), which plays significant roles in cell membrane organization, cell spreading, and migration .

Recombinant Mouse Myadml2 refers to the artificially synthesized form of this protein used in laboratory research to study its functions and interactions. Recombinant proteins are produced through genetic engineering techniques, wherein the gene encoding the protein of interest is inserted into an expression vector and introduced into host cells (typically bacteria, yeast, or mammalian cells) for protein production. This approach allows researchers to obtain pure protein samples for experimental applications, avoiding the complexities associated with extracting native proteins from biological tissues.

Gene Structure and Expression

The Myadml2 gene is a protein-coding gene identified in mouse genomes, particularly documented in Mus caroli (Ryukyu mouse) . According to the genetic database information, there are multiple transcript variants of Myadml2 that encode different isoforms of the protein:

mRNA TranscriptProtein ProductDescription
XM_029483056.1XP_029338916.1Myeloid-associated differentiation marker-like protein 2 isoform X1
XM_021178122.1XP_021033781.1Myeloid-associated differentiation marker-like protein 2 isoform X2
XM_021178121.1XP_021033780.1Myeloid-associated differentiation marker-like protein 2 isoform X1
XM_021178122.2XP_021033781.1Myeloid-associated differentiation marker-like protein 2 isoform X2

The existence of multiple isoforms suggests potential functional diversity, with each variant possibly serving distinct physiological roles .

Subcellular Localization

Gene Ontology annotations provide valuable insights into the cellular compartments where Myadml2 functions. According to these annotations, Myadml2 is localized in:

  1. Cytoplasm - Supported by evidence from sequence orthology with the human MYADML2 protein

  2. Membrane - Confirmed through multiple lines of evidence, including InterPro domain predictions and UniProt annotations

This dual localization pattern suggests that Myadml2 may shuttle between the cytoplasm and membrane compartments, potentially in response to cellular signaling events or during specific physiological processes.

Cellular ComponentEvidence TypeEvidence SourceReference
CytoplasmISO (Inferred from Sequence Orthology)MYADML2 (Homo sapiens)PMID:21325632
MembraneIEA (Inferred from Electronic Annotation)InterPro:IPR008253GO_REF:0000002
MembraneIEA (Inferred from Electronic Annotation)UniProtKB-KW:KW-0472GO_REF:0000043
MembraneIEA (Inferred from Electronic Annotation)UniProtKB-SubCell:SL-0162GO_REF:0000044

Potential Functional Roles

While specific functions of Myadml2 remain to be fully elucidated, its membrane localization and relationship to MYADM suggest potential roles in:

  1. Cell membrane organization and integrity

  2. Cell signaling pathways

  3. Immune cell function and differentiation

  4. Inflammatory responses

Comparative Analysis with MYADM

Understanding the better-characterized MYADM protein provides contextual insights into potential functions of Myadml2. MYADM was first identified in hematopoietic progenitor cells and is upregulated during myeloid differentiation . It has since been found expressed in multiple tissues, including spleen, lung, liver, kidney, testis, prostate, skeletal muscle, ovary, and peripheral blood leukocytes .

MYADM has been implicated in:

  1. Cell membrane organization for cell spreading and migration by recruiting Rac1 to membrane rafts

  2. Cell-cell junction formation in endothelial cells

  3. Regulation of inflammatory responses, particularly in the context of asthma and rhinovirus infection

Given the structural similarities between MYADM and Myadml2, some functional overlap may exist, though specific studies confirming these relationships for Myadml2 are needed.

Potential Role in Inflammatory Responses

Research on MYADM indicates its involvement in inflammatory pathways, particularly in airway epithelial cells during rhinovirus infection and asthmatic responses . MYADM expression correlates with several inflammatory markers and cytokines, including:

Inflammatory Factors Associated with MYADMTissue/Cell TypeReference
Interferon-lambda (IFN-λ)H1HeLa cells
IL-8H1HeLa cells
STAT-3H1HeLa cells
CLCA1H1HeLa cells
IFN-related genes (ISG15, USP18, IFNΛ-R1, IFN-β1)Airway epithelial cells
Cell receptors (TLR3, LDLR, ICAM-1, MDA5)Airway epithelial cells
STAT1 and CXCL11Airway epithelial cells

While these associations have been documented for MYADM, they provide potential directions for investigating Myadml2 functions, particularly in inflammatory contexts.

Recombinant Protein Production

Recombinant Mouse Myadml2 can be commercially produced in expression systems and is available for research purposes . These recombinant proteins serve as valuable tools for:

  1. Studying protein-protein interactions

  2. Developing antibodies against Myadml2

  3. Investigating signaling pathways involving Myadml2

  4. Functional assays to determine cellular effects

Potential Research Applications

Based on what is known about MYADM and the structural characteristics of Myadml2, several research applications can be envisioned:

  1. Investigation of Myadml2's role in membrane organization and dynamics

  2. Studies on immune cell function, particularly in myeloid lineage cells

  3. Research on inflammatory responses, especially in respiratory contexts

  4. Exploration of potential roles in cell migration and adhesion

Disease Associations

Given the association of MYADM with asthma and inflammatory responses , investigation of Myadml2's potential role in disease contexts represents an important research direction. Specific areas of interest may include:

  1. Respiratory diseases, particularly asthma and viral infections

  2. Inflammatory disorders

  3. Potential involvement in cancer processes, as suggested for other MYADM family members

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently available in our inventory. However, if you have specific format requirements, kindly include these details in your order remarks. We will accommodate your requests to the best of our ability.
Lead Time
Delivery times may vary depending on the purchasing method and location. For specific delivery timeframes, please consult your local distributors.
All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing of the product is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. To ensure long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting the solution. Store the aliquots at -20°C or -80°C. Our standard final glycerol concentration is 50%, which can be used as a reference for your own preparations.
Shelf Life
The shelf life of our proteins is influenced by various factors such as storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C or -80°C. The shelf life of the lyophilized form is 12 months at -20°C or -80°C.
Storage Condition
Upon receipt, store the protein at -20°C or -80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have specific tag type requirements, please communicate them to us. We will prioritize developing the specified tag if feasible.
Synonyms
Myadml2; Myeloid-associated differentiation marker-like protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-307
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Myadml2
Target Protein Sequence
MGSTMEPPGGAYLHLGAVTSPVGTARMLQLAFGCTTFSLVAHRGGFGGVQGTFCMAAWGF CFAFSVLVVACEFTKLHSCLRLSWGNFTAAFAMLATLLCATAAVIYPLYFTRLECPPEPA GCMVRNFRLAASVFAGLLFLAYAAEVALTRARPGQVASYMATVSGLLKIVQAFVACIIFG ALVHESRYGRYVATQWCVAVYSLCFMATVAVVVLSVMGHTAGLGCPFDRLVIVYTFLAVL LYLSAAVIWPVFCFDPKYGEPGRPADCLRGSCPWDSQLVVAIFTYVNLLLYIVDLAYSQR IRFVPTL
Uniprot No.

Target Background

Database Links
Protein Families
MAL family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the expression pattern of Myadml2 in mouse tissues?

Myadml2 belongs to the myeloid-associated differentiation marker family. While specific Myadml2 expression data is limited, related family members like MYADM show expression in multiple tissues including spleen, lung, liver, kidney, testis, prostate, skeletal muscle, ovary, and peripheral blood leukocytes . When designing experiments involving Myadml2, researchers should first conduct tissue-specific expression analysis using RT-PCR or immunohistochemistry to confirm expression patterns in target tissues. This is particularly important for determining physiologically relevant experimental models.

How should researchers design validation experiments for anti-Myadml2 antibodies?

Validate antibody specificity through multiple approaches: (1) Western blot analysis using tissues with known expression patterns alongside negative controls, (2) immunofluorescence studies with peptide competition assays, (3) comparative staining in wild-type versus Myadml2-knockout tissue, and (4) correlation between protein detection and mRNA expression data. For optimal results, use multiple antibodies targeting different epitopes and include appropriate positive and negative controls in all experiments to avoid false positives.

What are the optimal conditions for expressing recombinant mouse Myadml2 in vitro?

For successful recombinant expression of transmembrane proteins like Myadml2, consider these methodological approaches: (1) Use mammalian expression systems (HEK293 or CHO cells) rather than bacterial systems to ensure proper folding and post-translational modifications. (2) Incorporate a C-terminal purification tag (His-tag) similar to the approach used with related proteins . (3) Optimize culture conditions including temperature (30-37°C), induction time (24-72 hours), and cell density. (4) For purification, use a combination of affinity chromatography followed by size exclusion chromatography. (5) Verify protein integrity and functionality through Western blot analysis and appropriate activity assays.

How can researchers accurately assess Myadml2 subcellular localization?

For transmembrane proteins like Myadml2, subcellular localization studies require multiple complementary approaches: (1) Conduct confocal microscopy with fluorescently-tagged Myadml2 constructs, using co-localization markers for various cellular compartments (plasma membrane, nuclear membrane, endoplasmic reticulum). (2) Perform subcellular fractionation followed by Western blot analysis to biochemically confirm localization. (3) Use immunogold electron microscopy for highest-resolution localization data. Based on studies of related proteins, researchers should pay particular attention to cytoplasmic membranes and potential accumulation toward the cell surface, as MYADM shows varied localization patterns depending on cell type .

What controls are essential when studying Myadml2 expression changes in inflammatory models?

When examining Myadml2 regulation during inflammation, include these crucial controls: (1) Time-course studies with multiple timepoints to capture dynamic expression changes. (2) Comparison between active inflammatory stimuli and inactivated controls (e.g., viable virus vs. UV-inactivated virus, as demonstrated with MYADM ). (3) Parallel assessment of established inflammatory markers (cytokines, transcription factors) to correlate with Myadml2 expression. (4) Inclusion of both in vitro and in vivo models to confirm physiological relevance. (5) Cell-type specific analysis using flow cytometry or single-cell RNA sequencing to determine which specific cell populations modulate Myadml2 expression during inflammation.

How can researchers determine if Myadml2 plays a role in airway inflammation similar to MYADM?

To investigate Myadml2's potential role in airway inflammation: (1) Develop Myadml2-knockout mouse models or use CRISPR-Cas9 gene editing in airway epithelial cell models. (2) Compare inflammatory responses in wild-type versus Myadml2-deficient systems using established airway inflammation models (e.g., allergen challenge or viral infection). (3) Perform RNA-seq analysis to identify differentially regulated inflammatory pathways. (4) Assess specific inflammatory markers (IL-8, STAT1/3, TLR3) shown to be regulated by MYADM . (5) Use air-liquid interface cultures of primary airway epithelial cells to model physiologically relevant responses. This comparative approach will help establish whether Myadml2 shares MYADM's role in regulating inflammatory responses in airway epithelium.

What methodological approaches can distinguish between the roles of MYADM and Myadml2 in cell membrane organization?

To differentiate the membrane-organizing functions of these related proteins: (1) Perform rescue experiments in MYADM-knockdown cells by expressing either MYADM or Myadml2 and assessing restoration of membrane raft organization. (2) Use FRET (Förster Resonance Energy Transfer) microscopy to analyze protein-protein interactions with known membrane organizers like Rac1, which has been shown to interact with MYADM . (3) Apply advanced imaging techniques like super-resolution microscopy (STORM/PALM) to visualize nanoscale membrane domain organization. (4) Conduct lipidomic analysis of membrane microdomains in cells expressing or lacking each protein. (5) Use domain-swapping experiments between MYADM and Myadml2 to identify functional domains responsible for specific membrane-organizing activities.

How should researchers design experiments to investigate Myadml2's potential role in cell-cell junction formation?

For investigating Myadml2's role in cell junctions: (1) Establish inducible knockdown/knockout systems in epithelial or endothelial cell models. (2) Measure transepithelial/endothelial electrical resistance (TEER) to assess barrier function. (3) Perform calcium-switch assays to monitor junction assembly/disassembly dynamics. (4) Use live-cell imaging with fluorescently tagged junction proteins to track formation kinetics. (5) Assess localization of tight junction (ZO-1, claudins) and adherens junction (VE-cadherin, β-catenin) proteins in Myadml2-deficient cells. This approach mirrors studies with MYADM, which found that its knockdown impaired junction formation in endothelial cells , providing a methodological framework for investigating Myadml2's potential similar functions.

What are the most common pitfalls in quantifying Myadml2 expression changes during inflammatory responses?

Several technical challenges can impact accurate quantification: (1) Temporal considerations – insufficient timepoints may miss expression peaks. Use time-course experiments spanning 0-72 hours post-stimulus. (2) Cell heterogeneity – bulk analysis can mask cell-specific changes. Use cell sorting or single-cell approaches for accurate quantification. (3) Baseline variability – control for basal expression differences between experimental batches. (4) Antibody cross-reactivity – validate specificity against related family members through appropriate controls. (5) RNA-protein correlation issues – protein levels may not directly correlate with mRNA expression due to post-transcriptional regulation. Validate findings using both RT-qPCR and Western blot/ELISA techniques.

How can researchers resolve contradictory findings regarding Myadml2 localization across different cell types?

To address contradictory localization data: (1) Systematically compare expression systems (endogenous vs. overexpression) as overexpression can cause mislocalization. (2) Assess effects of tags and tag position (N- vs. C-terminal) on trafficking and localization. (3) Examine cell-type specific factors that might influence localization, including cell polarization status and culture conditions. (4) Consider developmental or activation state differences, as MYADM family proteins show dynamic localization patterns . (5) Employ multiple detection methods (biochemical fractionation, immunofluorescence, electron microscopy) to build consensus. This comprehensive approach helps distinguish genuine biological variability from technical artifacts.

What approaches help distinguish specific Myadml2 functions from redundant activities of related family members?

To address functional redundancy challenges: (1) Generate single and combined knockouts/knockdowns of Myadml2 and related proteins. (2) Perform rescue experiments with chimeric constructs containing domains from different family members. (3) Conduct comparative interactome analysis to identify unique and shared protein binding partners. (4) Use tissue-specific conditional knockout models to reveal context-dependent functions. (5) Employ dose-dependent approaches to identify potential compensation mechanisms. This systematic approach is essential as the MYADM protein family likely shows partial functional redundancy in processes like membrane organization and inflammatory regulation.

How might researchers investigate Myadml2's potential role in viral infections and host defense mechanisms?

Based on findings that MYADM is upregulated during rhinovirus infection , researchers investigating Myadml2's potential role in viral defense should: (1) Compare expression changes of Myadml2 across multiple viral infection models (respiratory viruses, DNA vs. RNA viruses). (2) Assess the impact of Myadml2 knockdown on viral replication kinetics and inflammatory cytokine production. (3) Investigate potential interactions with pattern recognition receptors like TLR3, which shows functional connections with MYADM . (4) Examine Myadml2 regulation by type I and III interferons and its potential role in interferon signaling pathways. (5) Use proteomics to identify virus-dependent changes in Myadml2 protein interactions that might reveal antiviral mechanisms.

What methodological considerations are important when investigating potential roles of Myadml2 in disease models beyond inflammation?

When expanding Myadml2 research to additional disease models: (1) First establish tissue-specific expression profiles to identify physiologically relevant disease models. (2) Consider developmental timing, as expression patterns may change during development and disease progression. (3) Use inducible systems rather than constitutive knockouts to avoid developmental compensation. (4) Employ multiple disease models to distinguish general versus disease-specific functions. (5) Correlate findings with human disease data when possible to establish translational relevance. This approach is particularly relevant given findings that related family member MYADM is implicated in multiple conditions including cancer and pulmonary hypertension .

How can advanced imaging techniques enhance understanding of Myadml2 dynamics during cell migration and membrane reorganization?

To capture dynamic membrane processes involving Myadml2: (1) Implement lattice light-sheet microscopy for extended 3D live-cell imaging with minimal phototoxicity. (2) Apply FRAP (Fluorescence Recovery After Photobleaching) to measure protein mobility within membrane domains. (3) Use TIRF (Total Internal Reflection Fluorescence) microscopy to selectively visualize membrane-proximal events. (4) Implement optogenetic tools to induce acute Myadml2 clustering or activation in specific membrane regions. (5) Combine correlative light and electron microscopy (CLEM) to connect functional dynamics with ultrastructural context. These advanced imaging approaches are particularly valuable for transmembrane proteins like Myadml2 that likely function in dynamic membrane organization processes similar to those documented for MYADM .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.