Recombinant Mouse N-acetylaspartate synthetase (Nat8l)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. To request a specific tag, please inform us; we will prioritize its development.
Synonyms
Nat8l; N-acetylaspartate synthetase; NAA synthetase; N-acetyltransferase 8-like protein; Protein Shati
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-299
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Nat8l
Target Protein Sequence
MHCGPPDMVCETKIVATEDHEALPGAKKDALLVAAGAMWPPLPAAPGPAAAPPPAAGPQP HGGTGGAGPPEGRGVCIREFRAAEQEAARRIFYDGILERIPNTAFRGLRQHPRTQLLYAL LAALCFAVTRSLLLTCLVPAGLLALRYYYSRKVILAYLECALHTDMADIEQYYMKPPGSC FWVAVLDGNVVGIVAARAHEEDNTVELLRMSVDSRFRGKSIAKALGRRVLEFAMLHNYSA VVLGTTAVKVAAHKLYESLGFRHMGASDHYVLPGMTLSLAERLFFQVRYHRYRLQLREE
Uniprot No.

Target Background

Function
Recombinant Mouse N-acetylaspartate synthetase (Nat8l) plays a crucial role in lipogenesis regulation by producing N-acetylaspartate (NAA), a brain-specific metabolite. NAA is highly concentrated in the brain, and its hydrolysis is vital for maintaining white matter integrity. Nat8l also promotes dopamine uptake by modulating TNF-alpha expression and attenuates methamphetamine-induced dopamine uptake inhibition.
Gene References Into Functions
  1. Striatal N-acetylaspartate synthetase (Shati/Nat8l) expression is implicated in major depressive disorder through metabotropic glutamate receptor 3-mediated regulation of the serotonergic system. PMID: 29020418
  2. Methamphetamine increases Shati/Nat8L mRNA via dopamine D1 receptor signaling and the CREB pathway in the mouse nucleus accumbens. This finding may aid in developing clinical tools for methamphetamine addiction treatment. PMID: 28319198
  3. Shati+/- and Shati-/- mice exhibit lower brain NAA levels compared to Shati+/+ mice, indicating SHATI's primary role in regulating brain NAA content. PMID: 26361739
  4. Neuronal Shati/Nat8l may induce axon outgrowth through ATP synthesis, independent of mGluR3 signaling. PMID: 26164607
  5. Dysregulated Nat8L expression correlates with oxidative phosphorylation deficits in the 5xFAD Alzheimer's disease model. PMID: 25766789
  6. Nucleus accumbens Shati/Nat8l, but not dorsal striatum Shati/Nat8l, suppresses behavioral responses to methamphetamine by controlling the dopaminergic system through group II mGlutamate receptor activation. PMID: 24559655
  7. NAT8L deletion increases dopamine D1 receptor cell surface expression in the nucleus accumbens, accelerating methamphetamine dependence in mice. PMID: 24246274
  8. Nat8l influences the brown adipogenic phenotype. PMID: 24155240
  9. SHATI deficiency may impact behavior. PMID: 22940080
  10. Shati expression affects emotional behaviors in mice. PMID: 22708272
  11. Nat8l-transfected cells exhibit over 300 times the Asp-NAT enzyme activity of mock-transfected controls, demonstrating exceptionally high aspartate specificity (less than 1% activity with glutamate). PMID: 20385109
  12. Nat8l exhibits high aspartate specificity, localizing to mitochondria and microsomes similarly to brain NAA. Its catalytic mechanism resembles NAG synthetase but does not involve cysteine. PMID: 20385109
  13. NAT8L, but not NAT14, catalyzes NAA synthesis from L-aspartate and acetyl-CoA. PMID: 19807691
  14. Shati's role in methamphetamine-regulated behavioral changes likely involves inhibiting methamphetamine-induced dopamine overflow in the nucleus accumbens and dopamine uptake reduction in the midbrain. PMID: 17626222
Database Links
Protein Families
Camello family
Subcellular Location
Cytoplasm. Membrane; Single-pass membrane protein. Microsome membrane; Single-pass membrane protein. Mitochondrion membrane; Single-pass membrane protein. Rough endoplasmic reticulum membrane; Single-pass membrane protein.
Tissue Specificity
Expressed in brain, kidney, liver and spleen. In brain, present in neurons but not in astrocytes (at protein level). Expressed in brain, thymus and spleen.

Q&A

What is Nat8l and what is its primary function?

Nat8l (N-acetyltransferase 8-like protein) is an enzyme that catalyzes the synthesis of N-acetylaspartate (NAA) through the transfer of an acetyl group from acetyl-CoA to aspartate. This reaction is essential for producing NAA, one of the most concentrated metabolites in the brain . The enzyme is predominantly expressed in neurons, particularly in their mitochondria, though it has also been detected in other tissues including brown adipose tissue .

From a biochemical perspective, Nat8l functions within a metabolic pathway that connects aspartate metabolism with acetyl-CoA utilization. The synthesis of NAA serves multiple physiological purposes, including acting as an extensive reservoir of acetate for acetyl coenzyme A synthesis in oligodendrocytes and other cell types . Additionally, Nat8l has been shown to promote dopamine uptake by regulating TNF-alpha expression and attenuates methamphetamine-induced inhibition of dopamine uptake .

Research has demonstrated that NAA synthesized by Nat8l participates in intercellular metabolite trafficking, contributing to the maintenance of acetyl-CoA levels, especially in conditions of metabolic stress. This makes Nat8l a critical enzyme at the intersection of multiple metabolic pathways in the nervous system and beyond.

What are the recommended methods for producing recombinant mouse Nat8l protein?

Production of recombinant mouse Nat8l typically involves bacterial expression systems, particularly E. coli, using a suitable expression vector containing the full-length mouse Nat8l cDNA. The gene sequence should be codon-optimized for the expression host to maximize protein yield. A purification tag (such as 6xHis or GST) should be included to facilitate downstream purification.

For optimal expression, consider the following protocol:

  • Clone the mouse Nat8l cDNA into an expression vector with an inducible promoter (e.g., pET or pGEX series)

  • Transform into an E. coli expression strain (BL21(DE3) or Rosetta)

  • Grow transformed bacteria at 37°C until OD600 reaches 0.6-0.8

  • Induce protein expression with IPTG (0.1-1.0 mM) at a reduced temperature (16-25°C) for 16-20 hours

  • Harvest cells and lyse using sonication or pressure-based methods

  • Purify using affinity chromatography based on the chosen tag

  • Perform buffer exchange to remove imidazole or other elution components

  • Verify protein purity using SDS-PAGE and western blotting

It's important to note that Nat8l is associated with mitochondrial membranes in vivo, so the recombinant protein may exhibit some hydrophobic properties. Including detergents in the purification buffers (such as 0.05% Triton X-100) may improve solubility. Additionally, testing enzyme activity immediately after purification is recommended, as recombinant Nat8l may lose activity during extended storage.

How can I measure Nat8l enzymatic activity in vitro?

Measuring Nat8l enzymatic activity involves detecting the production of NAA from aspartate and acetyl-CoA. Several established methods can be employed:

Spectrophotometric assay: This approach monitors the release of CoA-SH during the transfer of the acetyl group to aspartate. The free thiol group can be detected using 5,5'-dithiobis-(2-nitrobenzoic acid) (DTNB), which produces a yellow color measurable at 412 nm. The reaction mixture typically contains:

  • Purified recombinant Nat8l (1-10 μg)

  • L-aspartate (1-5 mM)

  • Acetyl-CoA (0.1-0.5 mM)

  • DTNB (0.1-0.2 mM)

  • Buffer (pH 7.4-8.0)

Radiochemical assay: Using [14C]-labeled acetyl-CoA or [14C]-labeled aspartate, NAA production can be measured by separating the reaction products using thin-layer chromatography or HPLC followed by scintillation counting. This method provides higher sensitivity compared to spectrophotometric approaches.

LC-MS/MS quantification: The most precise method involves direct quantification of NAA using liquid chromatography coupled with tandem mass spectrometry. This approach allows detection of NAA with high specificity and sensitivity, enabling accurate determination of enzyme kinetics.

For all methods, it's essential to include appropriate controls:

  • No-enzyme control to determine background reactions

  • Heat-inactivated enzyme to confirm enzymatic nature

  • Known NAA standards for calibration

  • Inhibitor controls (if available)

Enzymatic parameters such as Km and Vmax can be determined by varying substrate concentrations and analyzing the data using Michaelis-Menten or Lineweaver-Burk plots.

What subcellular localization does Nat8l exhibit, and how can it be studied?

Nat8l primarily localizes to mitochondria in neurons, although some studies suggest a possible cytosolic component of NAA synthesis as well . To study the subcellular localization of Nat8l, researchers can employ several complementary techniques:

Immunofluorescence microscopy: Using specific antibodies against Nat8l, researchers can visualize its distribution within cells. Co-staining with mitochondrial markers (such as MitoTracker dyes or antibodies against mitochondrial proteins like COX IV) can confirm mitochondrial localization. This approach is particularly useful for analyzing endogenous Nat8l in neuronal cultures or tissue sections.

Subcellular fractionation: Differential centrifugation can separate cellular components based on size and density. Western blotting of the resulting fractions using Nat8l antibodies can determine its distribution across cellular compartments. This method should include markers for different cellular compartments (mitochondria, cytosol, nucleus, etc.) to verify proper fractionation.

Electron microscopy: Immunogold labeling combined with electron microscopy provides the highest resolution for precise subcellular localization, allowing visualization of Nat8l within specific mitochondrial compartments.

Studies employing these techniques have shown that while Nat8l is predominantly associated with mitochondria, the mitochondrial localization signal in Nat8l is not as clearly defined as in many other mitochondrial proteins. This suggests a complex regulation of its subcellular distribution, potentially related to its dual role in metabolite synthesis and intercellular trafficking .

How does Nat8l expression and activity change in pathological conditions?

Nat8l expression and activity undergo significant alterations in various pathological conditions, particularly in brain injury, neurodegenerative diseases, and cancer. These changes appear to reflect adaptive or maladaptive responses to metabolic stress and cellular damage.

In traumatic brain injury (TBI), NAA levels decrease rapidly, paralleling reductions in ATP levels, suggesting compromised energy metabolism . This reduction is believed to result from both decreased synthesis due to mitochondrial dysfunction and increased degradation. Interestingly, during recovery from TBI, the expression of both Nat8l and the enzymes involved in NAA metabolism (particularly AceCS1) increases significantly, potentially reflecting a compensatory mechanism to restore acetyl-CoA availability for lipid synthesis and protein acetylation reactions .

In Alzheimer's disease, preliminary investigations have shown increased rates of NAA synthesis despite decreased total NAA levels. This apparent paradox suggests a compensatory increase in Nat8l activity in the remaining neuronal population trying to maintain NAA levels as neurons are lost . This finding highlights the complexity of NAA metabolism in neurodegenerative conditions.

The table below summarizes key changes in Nat8l/NAA in different pathological conditions:

What are the most effective approaches for knockdown or knockout of Nat8l in experimental models?

Several approaches have proven effective for modulating Nat8l expression in experimental models, each with distinct advantages for different research questions:

siRNA/shRNA-mediated knockdown: This approach has been successfully used in multiple cancer cell lines including A2780 ovarian cancer cells, where Nat8l knockdown significantly reduced cell proliferation . For optimal results:

  • Design at least 3-4 different siRNA sequences targeting different regions of Nat8l mRNA

  • Validate knockdown efficiency by qRT-PCR and western blotting

  • Use appropriate transfection methods (lipid-based for most cell lines, electroporation for hard-to-transfect cells)

  • Include proper controls (non-targeting siRNA with similar GC content)

  • Consider the temporal limitations of siRNA (typically 3-5 days of knockdown)

CRISPR/Cas9 genome editing: For stable knockout models, CRISPR/Cas9 targeting of the Nat8l gene provides a more permanent approach:

  • Design guide RNAs targeting early exons of the Nat8l gene

  • Screen edited clones using sequencing to identify frameshift mutations

  • Validate knockout at protein level using western blotting

  • Characterize potential compensatory mechanisms that may emerge in knockout clones

Conditional knockout mice: For in vivo studies, conditional knockout models offer the advantage of tissue-specific or temporally controlled Nat8l deletion:

  • Employ Cre-loxP system with Nat8l-floxed mice

  • Use neuron-specific promoters (e.g., Thy1, CamKII) for brain-specific studies

  • Use inducible systems (e.g., tamoxifen-inducible CreERT2) for temporal control

  • Validate knockouts using tissue-specific RNA and protein analysis

Antisense oligonucleotides (ASOs): For in vivo studies where conditional knockout animals are not available, ASOs can provide an alternative approach:

  • Design ASOs targeting Nat8l mRNA with appropriate chemical modifications (e.g., phosphorothioate backbone, 2'-O-methoxyethyl modifications)

  • Deliver through appropriate routes (intracerebroventricular injection for brain studies)

  • Validate knockdown efficiency through qRT-PCR and western blotting

When selecting an approach, researchers should consider the degree and duration of knockdown required, the specific model system, and the experimental timeline. Additionally, phenotypic changes following Nat8l manipulation should be carefully characterized, including NAA levels, acetyl-CoA metabolism, and downstream cellular processes such as lipid synthesis and protein acetylation.

How does Nat8l interact with metabolic pathways beyond NAA synthesis?

Nat8l plays a multifaceted role in cellular metabolism that extends well beyond its canonical function in NAA synthesis. These broader interactions position Nat8l at the intersection of several key metabolic pathways with implications for energy metabolism, lipid synthesis, and epigenetic regulation.

In brown adipocytes, Nat8l expression has been shown to induce de novo lipogenesis and promote the brown adipocyte phenotype . This suggests a regulatory role in cellular differentiation and metabolic programming. The mechanism appears to involve NAA-derived acetate contributing to lipid synthesis pathways after being converted to acetyl-CoA.

The connection between Nat8l activity and acetyl-CoA metabolism is particularly significant. As NAA is one of the most concentrated acetylated metabolites in the brain, it serves as an extensive reservoir of acetate for acetyl-CoA synthesis . This acetyl-CoA can subsequently be utilized for:

  • Energy derivation through the TCA cycle

  • Lipid synthesis, particularly during myelination

  • Protein acetylation reactions, including histone acetylation

Regarding protein acetylation, studies have shown that NAA-derived acetate contributes to nuclear histone acetylation. This connects Nat8l activity to epigenetic regulation of gene expression . Supporting this connection, the acetyl-CoA synthetase enzymes AceCS1 and AceCS2, which convert acetate to acetyl-CoA, are upregulated after traumatic brain injury alongside increased Nat8l expression .

In cancer metabolism, Nat8l appears to influence multiple pathways. Microarray analysis of cells treated with siNAT8L revealed significant changes in gene expression patterns, with pathway enrichment analysis identifying FOXM1 signaling as significantly downregulated . This suggests that Nat8l activity may influence transcriptional networks governing cell proliferation and survival.

Intercellular metabolite trafficking also involves Nat8l products. The compartmentalized nature of NAA synthesis (primarily in neurons) and degradation (primarily in oligodendrocytes) necessitates intercellular transfer of NAA . This metabolite trafficking supports oligodendrocyte metabolism and myelin synthesis, revealing Nat8l's role in coordinating metabolic cooperation between different cell types in the brain.

What technical challenges exist in studying Nat8l activity in different tissues?

Studying Nat8l activity across different tissues presents several technical challenges that researchers must address to obtain reliable and interpretable results:

Varying expression levels: Nat8l expression exhibits substantial tissue heterogeneity, with highest expression in the brain, particularly in neurons, and significant expression in brown adipose tissue . Other tissues show much lower expression levels, making detection challenging. Researchers should:

  • Use highly sensitive detection methods for low-expressing tissues

  • Employ enrichment techniques when possible

  • Consider targeted approaches rather than global profiling

Subcellular localization complexity: While primarily considered a mitochondrial enzyme, evidence suggests that Nat8l may also function in the cytoplasm, with different contributions to NAA synthesis in different compartments . This dual localization complicates activity measurements from whole tissue extracts. Approaches to address this include:

  • Performing subcellular fractionation before activity assays

  • Using in situ activity assays when possible

  • Employing imaging techniques that can distinguish compartment-specific activity

Rapid post-mortem changes: NAA levels and Nat8l activity can change rapidly after tissue collection due to ongoing metabolism and enzyme degradation. This is particularly problematic for human samples and can introduce variability in animal studies. Researchers should:

  • Standardize and minimize time between euthanasia and tissue processing

  • Consider flash-freezing techniques

  • Use metabolic inhibitors during tissue preparation when appropriate

Metabolite stability issues: NAA itself can degrade during sample preparation and storage, potentially leading to underestimation of Nat8l activity. To address this:

  • Optimize extraction procedures to minimize NAA degradation

  • Include internal standards for NAA quantification

  • Consider measuring multiple NAA-related metabolites to create a more complete profile

Overlapping metabolic pathways: NAA is connected to multiple metabolic pathways, making it difficult to isolate Nat8l-specific effects. When studying NAA production:

  • Use isotope labeling approaches to track specific metabolic routes

  • Include measurements of related metabolites (aspartate, acetyl-CoA, acetate)

  • Consider inhibitor studies to block specific pathways

  • Employing laser capture microdissection for cell-specific analyses

  • Using single-cell techniques when appropriate

  • Correlating activity measurements with cell-type marker expression

A particularly effective approach for overcoming many of these challenges is the use of stable isotope-labeled precursors combined with mass spectrometry. For example, using 13C-labeled glucose or acetate allows researchers to trace the metabolic fate of these precursors into NAA, providing dynamic information about Nat8l activity rather than static measurements of NAA levels .

How can researchers effectively measure NAA levels as a readout of Nat8l activity?

Accurate measurement of NAA levels is essential for assessing Nat8l activity in research settings. Several methodologies are available, each with distinct advantages depending on the experimental context:

Magnetic Resonance Spectroscopy (MRS): This non-invasive technique is particularly valuable for in vivo studies and longitudinal experiments:

  • Proton MRS (1H-MRS) can detect NAA based on its characteristic peak at 2.02 ppm

  • Allows repeated measurements in the same subject over time

  • Provides spatial information about NAA distribution in tissues

  • Limited by relatively low sensitivity (detection limit ~0.5-1 mM)

  • Requires careful peak assignment and quantification to distinguish NAA from other N-acetylated compounds

High-Performance Liquid Chromatography (HPLC):

  • Can be coupled with various detection methods (UV, fluorescence, electrochemical)

  • Offers good sensitivity and specificity when optimized

  • Requires sample extraction and preparation

  • Most effective when combined with internal standards for quantification

  • Can separate NAA from other metabolites with similar properties

Liquid Chromatography-Mass Spectrometry (LC-MS/MS):

  • Provides the highest sensitivity and specificity for NAA quantification

  • Enables absolute quantification using isotope-labeled internal standards

  • Can detect NAA in the nanomolar range

  • Allows simultaneous measurement of multiple metabolites in the NAA pathway

  • Requires specialized equipment and expertise

  • Sample preparation is critical for reliable results

Enzymatic Assays:

  • Based on coupled reactions utilizing aspartoacylase (ASPA) to cleave NAA

  • Can be adapted for high-throughput screening

  • Less specific than chromatographic methods

  • Useful for relative comparisons rather than absolute quantification

13C-Labeling Studies:

  • Provide dynamic information about NAA synthesis rates

  • Can distinguish newly synthesized NAA from existing pools

  • Require infusion of labeled precursors (e.g., 13C-glucose)

  • Analysis typically performed by MRS or MS

  • Allow calculation of synthesis rates rather than just steady-state levels

For accurate assessment of Nat8l activity, researchers should consider the following guidelines:

  • Include appropriate controls, particularly for sample handling and storage, as NAA can degrade under certain conditions.

  • When possible, measure both NAA and related metabolites (aspartate, acetate) to provide context.

  • In cell culture experiments, normalize NAA measurements to cell number or protein content.

  • For in vivo studies, consider regional variations in NAA concentrations, particularly in the brain.

  • When comparing across studies, be aware of methodological differences that may affect absolute quantification.

The table below summarizes the characteristics of different NAA measurement techniques:

MethodSensitivitySpecificitySample RequirementsIn vivo ApplicationEquipment Complexity
MRSModerateModerateNon-invasiveYesHigh
HPLCHighHighTissue extractNoModerate
LC-MS/MSVery HighVery HighTissue extractNoHigh
Enzymatic AssayModerateModerateTissue extractNoLow
13C-LabelingHighVery HighLabeled precursor administrationYes (with MRS)High

What are the key considerations when designing experiments to study Nat8l function?

Designing robust experiments to investigate Nat8l function requires careful attention to several key factors that can significantly impact results and their interpretation:

Selection of appropriate model systems: Different experimental models offer distinct advantages for studying specific aspects of Nat8l function:

  • Neuronal cell lines (e.g., SH-SY5Y, primary neurons) are suitable for studying NAA synthesis in a neuronal context

  • Brown adipocyte models for investigating Nat8l's role in adipocyte metabolism and differentiation

  • Cancer cell lines for studying oncogenic functions

  • Mouse models for system-level investigations and in vivo relevance

The choice should be guided by the specific research question and the known expression pattern of Nat8l in these systems. For instance, studies focused on NAA's role in myelination would benefit from co-culture systems that include both neurons and oligodendrocytes.

Temporal considerations: Nat8l expression and NAA synthesis rates change during development and in response to various stimuli. Researchers should:

  • Consider developmental timing, particularly for studies related to myelination

  • Allow sufficient time for metabolic changes to manifest following Nat8l manipulation

  • Design time-course experiments to capture dynamic processes

  • Account for the relatively slow turnover rate of NAA (complete turnover occurring every 2-3 days in adult rat brain)

Metabolic context: As Nat8l functions within a complex metabolic network, experimental conditions that alter cellular metabolism can significantly impact results:

  • Control nutritional status and medium composition in cell culture experiments

  • Consider the impact of anesthesia on brain metabolism in animal studies

  • Account for circadian variations in metabolic activity

  • Standardize fasting/feeding status for in vivo experiments

Technical validation: Multiple complementary approaches should be used to validate findings:

  • Confirm Nat8l knockdown/overexpression at both mRNA and protein levels

  • Verify changes in NAA levels using appropriate analytical methods

  • Include rescue experiments (e.g., NAA supplementation after Nat8l knockdown)

  • Use multiple independent methods to assess downstream effects

Controls and normalization: Proper experimental controls are essential:

  • Include appropriate vehicle controls for all treatments

  • Use scrambled/non-targeting controls for RNA interference experiments

  • For tissue analyses, consider region-specific and cell-type-specific controls

  • Normalize metabolite measurements to relevant parameters (protein content, cell number, tissue weight)

Pathway integration: Given Nat8l's position at the intersection of multiple metabolic pathways, comprehensive experimental designs should assess:

  • Aspartate availability and metabolism

  • Acetyl-CoA levels and turnover

  • Related metabolic pathways (TCA cycle, lipid synthesis)

  • Downstream processes (protein acetylation, gene expression)

By carefully addressing these considerations, researchers can design experiments that provide meaningful insights into Nat8l function while minimizing confounding factors and experimental artifacts.

How can researchers distinguish between direct and indirect effects of Nat8l manipulation?

Distinguishing between direct consequences of Nat8l activity and secondary effects presents a significant challenge in research. Several experimental strategies can help researchers make this critical distinction:

Temporal analysis: Direct effects of Nat8l manipulation typically occur more rapidly than indirect effects. By conducting time-course experiments following Nat8l knockdown or overexpression, researchers can often separate primary from secondary consequences. For example, changes in NAA levels would be expected to precede alterations in lipid composition or gene expression patterns.

Metabolic rescue experiments: One of the most powerful approaches involves attempting to rescue phenotypes through metabolite supplementation:

  • If NAA supplementation rescues the effects of Nat8l knockdown (as demonstrated in cancer cell proliferation studies) , this suggests the effects are directly related to NAA production rather than other potential functions of Nat8l

  • If acetate supplementation produces similar rescue effects, this would implicate the acetate moiety of NAA as the critical factor

  • Partial rescue may indicate both direct and indirect mechanisms

Pathway inhibition studies: Selectively blocking downstream pathways can help determine which effects are mechanistically linked to Nat8l:

  • Inhibiting acetyl-CoA synthetases (AceCS1/AceCS2) would block the utilization of NAA-derived acetate

  • Targeting specific transcription factors identified in pathway analysis of Nat8l knockdown (e.g., FOXM1) can help validate proposed regulatory mechanisms

  • Combining Nat8l manipulation with inhibition of potentially related pathways can reveal functional interactions

Stable isotope tracing: Using isotopically labeled precursors (13C-glucose, 13C-acetate) can track the metabolic fate of NAA and identify direct metabolic consequences of Nat8l activity:

  • Incorporation of label into NAA and subsequent transfer to acetyl-CoA, lipids, or protein acetylation

  • Changes in labeling patterns following Nat8l manipulation provide direct evidence of metabolic rewiring

  • Comparison of labeling kinetics across different metabolites can indicate primary versus secondary effects

Correlation analysis: In studies examining multiple parameters:

  • Strong correlation between NAA levels and a specific outcome suggests a direct relationship

  • Weaker or delayed correlations may indicate indirect effects

  • Multivariate analysis can help identify clusters of directly and indirectly affected processes

Domain-specific mutants: Creating Nat8l variants with altered enzymatic activity or subcellular localization:

  • Catalytically inactive mutants that maintain protein-protein interactions can separate enzymatic from structural roles

  • Localization mutants can distinguish between mitochondrial and cytosolic functions

  • Comparing phenotypes between wild-type and mutant complementation can reveal mechanism-specific effects

When reporting results, researchers should clearly distinguish between demonstrated direct effects and potential indirect consequences, avoiding overinterpretation of correlative findings. The experimental approaches described above, particularly when used in combination, provide a robust framework for establishing mechanistic relationships between Nat8l activity and downstream cellular processes.

How do posttranslational modifications regulate Nat8l activity?

Posttranslational modifications (PTMs) of Nat8l represent an important yet understudied aspect of its regulation. While comprehensive characterization of Nat8l PTMs remains incomplete, existing evidence points to several modifications that likely influence its activity, localization, and stability.

Phosphorylation: Bioinformatic analyses predict multiple potential phosphorylation sites in Nat8l. Phosphorylation could regulate:

  • Enzyme activity through conformational changes

  • Protein-protein interactions

  • Subcellular localization

  • Protein stability and turnover

Acetylation: Given Nat8l's involvement in acetyl group metabolism, it's particularly interesting to consider whether the enzyme itself might be regulated by acetylation. Protein acetylation is increasingly recognized as a major regulatory mechanism connecting metabolism to enzyme function. Acetylation could potentially:

  • Create a feedback loop regulating Nat8l activity based on acetyl-CoA availability

  • Influence protein stability

  • Modulate protein-protein interactions

Ubiquitination and protein turnover: The regulation of Nat8l protein levels through ubiquitin-mediated degradation represents another potential control point. Preliminary evidence suggests that Nat8l protein levels can change rapidly in response to certain stimuli, indicating active regulation of protein stability.

Methodological approaches to study Nat8l PTMs:

  • Mass spectrometry-based proteomics:

    • Immunoprecipitation of endogenous or tagged Nat8l followed by LC-MS/MS analysis

    • Enrichment strategies for specific PTMs (phosphopeptide enrichment, acetyl-lysine antibodies)

    • Quantitative proteomics to compare modification states under different conditions

  • Site-directed mutagenesis:

    • Creation of non-modifiable mutants (e.g., S→A for phosphorylation sites, K→R for acetylation sites)

    • Expression of these mutants in Nat8l-knockout backgrounds to assess functional consequences

    • Phosphomimetic mutations (S→D or S→E) to simulate constitutive phosphorylation

  • Protein stability and turnover analysis:

    • Cycloheximide chase experiments to measure protein half-life under different conditions

    • Proteasome inhibitors to assess contribution of ubiquitin-mediated degradation

    • Ubiquitination assays to directly measure ubiquitin conjugation

  • Enzyme activity correlations:

    • Correlation of Nat8l activity with specific PTM states

    • Manipulation of relevant kinases, phosphatases, acetyltransferases, or deacetylases

    • In vitro reconstitution of enzyme regulation with purified components

It's worth noting that while these approaches provide powerful tools for investigating Nat8l PTMs, comprehensive studies specifically addressing this aspect of Nat8l regulation are currently limited in the literature. This represents an important area for future research, particularly given the enzyme's involvement in both normal physiology and pathological conditions.

What are the best animal models for studying Nat8l function in vivo?

Animal models provide essential insights into the systemic roles of Nat8l and its product NAA that cannot be fully recapitulated in cell culture systems. Several models have been developed or could be employed to study different aspects of Nat8l function:

Nat8l knockout mice: Complete Nat8l knockout mice show a dramatic reduction (>80%) in brain NAA levels, confirming the enzyme's primary role in NAA synthesis. These mice exhibit:

  • Reduced brain weight with relatively normal gross brain morphology

  • Behavioral abnormalities including reduced motor activity

  • Compromised myelin lipid synthesis

  • Reduced acetyl-CoA levels in oligodendrocytes

Conditional Nat8l knockout models: To overcome the limitations of constitutive knockouts, conditional models using Cre-loxP technology allow tissue-specific or temporally controlled Nat8l deletion:

  • Neuron-specific deletion to study the impact of neuronal NAA reduction

  • Inducible systems to examine acute versus chronic NAA depletion

  • Region-specific targeting to investigate brain area-specific functions

These models provide more precise tools for dissecting the cell-type-specific roles of Nat8l and for separating developmental from adult functions.

Nat8l overexpression models: Transgenic mice overexpressing Nat8l in specific tissues can reveal the consequences of increased NAA production:

  • Neuron-specific overexpression to study the impact of elevated NAA in the brain

  • Adipocyte-targeted expression to investigate metabolic effects

  • Cancer models with Nat8l overexpression to examine its role in tumor progression

Complementary disease models:

  • Aspa knockout mice, which model Canavan disease, cannot metabolize NAA and develop severe neurological phenotypes

  • Studying Nat8l function in these mice helps distinguish NAA synthesis from catabolism effects

  • Traumatic brain injury models show dynamic changes in NAA levels and Nat8l expression

  • Models of neurodegenerative diseases can reveal how Nat8l responds to neuronal stress

Xenograft models for cancer studies:

  • Implantation of cancer cells with modified Nat8l expression into immunocompromised mice

  • Allow assessment of Nat8l's role in tumor growth, metastasis, and response to therapy

  • Have demonstrated reduced tumor growth following Nat8l silencing in ovarian cancer and melanoma models

Considerations for working with these models:

  • Measurement techniques: Reliable methods for measuring NAA in animal tissues include extraction followed by LC-MS/MS analysis or in vivo magnetic resonance spectroscopy for longitudinal studies.

  • Developmental timing: The role of NAA in myelination suggests particular attention to developmental stages when selecting experimental timepoints.

  • Metabolic conditions: Standardization of feeding/fasting state, time of day, and other variables that affect metabolism.

  • Background strain effects: Genetic background can significantly impact phenotypes in mouse models, necessitating appropriate controls and consideration of strain-specific effects.

  • Sex differences: Both NAA metabolism and the phenotypes of interest (particularly in cancer and neurological studies) may show sex-specific effects that should be systematically addressed.

The table below summarizes key animal models for studying Nat8l function:

Model TypeKey FeaturesBest ApplicationsLimitations
Global Nat8l KO>80% reduction in brain NAADevelopmental roles of NAAPotential compensatory mechanisms
Conditional Nat8l KOCell-type specific NAA reductionCell-autonomous functionsTechnical complexity
Inducible Nat8l KOTemporal control of NAA reductionAcute vs. chronic effectsVariable efficiency of induction
Nat8l OverexpressionIncreased NAA productionGain-of-function studiesPotential non-physiological effects
Aspa KO (Canavan model)NAA accumulationNAA catabolismSevere phenotype limits some studies
Cancer XenograftsHuman cancer cells in miceOncogenic functionsImmune component missing

What contradictions exist in the current understanding of Nat8l function?

The literature on Nat8l function contains several apparent contradictions and unresolved questions that warrant careful consideration when designing and interpreting experiments. Being aware of these discrepancies can help researchers formulate more nuanced hypotheses and experimental approaches.

  • Cell-type specific differences in Nat8l localization

  • Dynamic regulation of Nat8l trafficking between compartments

  • Technical limitations in subcellular fractionation methods

  • Different experimental conditions affecting metabolite availability

Developmental versus adult functions: NAA is critical during development, particularly for myelination, but its roles in the adult brain remain incompletely understood. Some studies suggest NAA primarily serves developmental functions, while others indicate ongoing roles in adult brain metabolism. This apparent contradiction may reflect:

  • Multiple functions of NAA at different developmental stages

  • Regional differences in NAA utilization

  • Compensatory mechanisms that emerge in chronic NAA depletion

  • Challenges in distinguishing direct versus indirect effects of NAA reduction

Tumor-promoting versus tumor-suppressing effects: While most cancer studies indicate that Nat8l expression promotes tumor growth and correlates with worse outcomes , there are contexts where NAA metabolism appears to suppress malignancy. This discrepancy might result from:

  • Cancer type-specific metabolic requirements

  • Different roles of NAA in cancer initiation versus progression

  • Variation in the expression of enzymes that metabolize NAA

  • Context-dependent interactions with other metabolic pathways

NAA turnover rate variations: Studies measuring NAA synthesis rates have reported substantially different values, ranging from complete turnover every 2-3 days to much slower rates . These differences have been attributed to:

  • Methodological variations (precursor choice, detection methods)

  • Regional differences within the brain (gray versus white matter)

  • Age-dependent changes in NAA metabolism

  • Species differences

Metabolic versus signaling functions: While many studies focus on NAA's role as a metabolic intermediate providing acetate for lipid synthesis and protein acetylation, some evidence suggests NAA might also serve signaling functions. The relative importance of these different functions remains unresolved and may vary by:

  • Cell type and developmental stage

  • Pathological context

  • Subcellular compartment

Addressing these contradictions:

To advance our understanding of Nat8l function, researchers should:

  • Explicitly acknowledge these contradictions when designing studies and interpreting results

  • Use multiple complementary approaches to address each research question

  • Carefully control and report experimental conditions that might influence outcomes

  • Consider cell type, developmental stage, and disease context as critical variables

  • Develop more sensitive and specific methods for tracking NAA metabolism in real-time

  • Design experiments that can directly test competing hypotheses

By systematically addressing these contradictions, the field can move toward a more unified understanding of Nat8l's diverse functions across physiological and pathological contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.