Recombinant Mouse N-acetylglucosamine-1-phosphotransferase subunits alpha/beta (Gnptab)

Shipped with Ice Packs
In Stock

Description

General Information

The Gnptab gene provides the necessary instructions for creating the alpha and beta subunits of GlcNAc-1-phosphotransferase, an enzyme . This enzyme comprises two alpha, two beta, and two gamma subunits, with the gamma subunit originating from a separate gene known as GNPTG . GlcNAc-1-phosphotransferase is crucial in preparing newly synthesized enzymes for transportation to lysosomes, which are cell compartments that employ hydrolases to break down large molecules .

GlcNAc-1-phosphotransferase facilitates the production of mannose-6-phosphate (M6P), acting as a tag that directs hydrolases to the lysosome . It transfers a GlcNAc-1-phosphate molecule to a newly produced hydrolase .

Function and Importance

Gnptab is essential for the correct functioning of GlcNAc-1-phosphotransferase, which plays a vital role in lysosomal enzyme targeting . Mice lacking GlcNAc-1-phosphotransferase activity exhibit symptoms similar to those observed in humans with mucolipidosis types II and III . These symptoms include elevated plasma levels of lysosomal acid hydrolases due to the missing mannose 6-phosphate targeting signal .

Impact of Mutations

  • Elevated Plasma Levels of Acid Hydrolases: Missense mutations in Gnptab can result in increased plasma activity levels of lysosomal acid hydrolases in mice . For example, GnptabSer321Gly mice displayed a 1.26- to 3.3-fold increase in the plasma activity level of β-hexosaminidase, α-mannosidase, and β-mannosidase .

  • White Matter Deficits: Studies using diffusion tensor imaging (DTI) have revealed white matter deficits in Gnptab Ser321Gly mice . Specifically, there was a significantly reduced local volume in the genu of the corpus callosum (CC) in these mice .

  • Increased Interbout Pause Durations: Gfap-specific Gnptab knockout mice showed significantly increased interbout pause durations . This was observed in conditional heterozygote knockouts (cHET) .

Research Findings

Research has focused on understanding the effects of GNPTAB mutations on various functions in mice. Some key findings include:

  • Vocalization Phenotypes: GnptabAla455Ser mice vocalizations showed slight phenotypic differences, particularly when using different syllable cutoff values .

  • Conditional Knockout Mice: Conditional knockout mice carrying the loxP sequence in the flanking regions of exon 2 of Gnptab were created to study astrocyte-specific knockout effects .

  • Gnptab as a Host Factor: GNPTAB has been identified as a host factor for Ebola virus (EBOV) infection .

Data Tables

Table 1: Plasma Levels of Acid Hydrolases in Gnptab Ser321Gly Mice

Acid HydrolaseWild-Type MiceGnptabSer321Gly MiceFold Increase
β-HexosaminidaseXY1.26-3.3
α-MannosidaseXY1.26-3.3
β-MannosidaseXY1.26-3.3
β-GalactosidaseXYNS
β-GlucuronidaseXYNS

Note: NS = No significant difference. Actual values (X, Y) not available in the original paper, but fold increase is reported .

Table 2: DTI Analysis of White Matter in Gnptab Ser321Gly Mice

Brain RegionWild-Type Mice (Mean ± SEM)Mut/Mut Mice (Mean ± SEM)P-Value
Genu of CC (LogJ)-0.017 ± 0.011-0.16 ± 0.0120.025
Anterior CommissureXY0.26
SpleniumXY0.67
HippocampusXY0.97

Note: Actual LogJ values (X, Y) not available for all regions in the original paper .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you have specific format requirements, please indicate them during order placement.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Gnptab; Gnpta; Kiaa1208; N-acetylglucosamine-1-phosphotransferase subunits alpha/beta; GlcNAc-1-phosphotransferase subunits alpha/beta; Stealth protein GNPTAB; UDP-N-acetylglucosamine-1-phosphotransferase subunits alpha/beta
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
908-1235
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Gnptab
Target Protein Sequence
DTFADSLRYVNKILNSKFGFTSRKVPAHMPHMIDRIVMQELQDMFPEEFDKTSFHKVRHS EDMQFAFSYFYYLMSAVQPLNISQVFHEVDTDQSGVLSDREIRTLATRIHDLPLSLQDLT GLEHMLINCSKMLPANITQLNNIPPTQEAYYDPNLPPVTKSLVTNCKPVTDKIHKAYKDK NKYRFEIMGEEEIAFKMIRTNVSHVVGQLDDIRKNPRKFVCLNDNIDHNHKDARTVKAVL RDFYESMFPIPSQFELPREYRNRFLHMHELQEWRAYRDKLKFWTHCVLATLIIFTIFSFF AEQIIALKRKIFPRRRIHKEASPDRIRV
Uniprot No.

Target Background

Function

This protein catalyzes the formation of mannose 6-phosphate (M6P) markers on high-mannose type oligosaccharides within the Golgi apparatus. M6P residues are crucial for binding to mannose 6-phosphate receptors (MPRs), which mediate the vesicular transport of lysosomal enzymes to the endosomal/prelysosomal compartment.

Gene References Into Functions
  1. A novel mouse model of MLII homozygous for a patient mutation in the GNPTAB gene. PMID: 25107912
  2. The DMAP interaction domain of the alpha subunit plays a role in the selective recognition of acid hydrolase substrates, explaining impaired acid hydrolase phosphorylation in mucolipidosis II patients. PMID: 23733939
  3. Retinal degeneration and storage disease phenotype in most exocrine glands observed in Gnptab null mice. PMID: 19261645
  4. Vacuolization in mucolipidosis type II mouse exocrine gland cells (GlcNAc-1-phosphotransferase-deficient mice) indicates the accumulation of autolysosomes. PMID: 21325625
Database Links
Protein Families
Stealth family
Subcellular Location
[N-acetylglucosamine-1-phosphotransferase subunit alpha]: Golgi apparatus membrane; Single-pass type I membrane protein.; [N-acetylglucosamine-1-phosphotransferase subunit beta]: Golgi apparatus membrane; Single-pass type II membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.