Recombinant Mouse N-acetyltransferase 14 (Nat14)

Shipped with Ice Packs
In Stock

Description

General Information

  • Nomenclature: Nat14 is also known as K562 cell-derived leucine-zipper-like protein 1 (KLP1) .

  • Function: Nat14 is a probable acetyltransferase that may act as a transcription factor regulating the expression of coproporphyrinogen oxidase by binding to a promoter regulatory element .

  • Expression: Recombinant Nat14 can be expressed in various systems, including cell-free protein synthesis .

  • Structure: Computational analysis has revealed that KLP1 (Nat14) has a leucine-zipper-like structure, a Leu-X-X-Leu-Leu motif .

Production and Characterization of Recombinant Mouse Nat14

Recombinant Nat14 is produced to facilitate in vitro studies of its enzymatic activity, substrate specificity, and interactions with inhibitors .

  • Expression Systems: Recombinant mouse Nat2 (the mouse equivalent of human NAT1) has been expressed in hamster cells and purified for characterization .

  • Purification: Recombinant proteins can be purified using affinity tags such as Strep-tag .

  • Concentration Measurement: The concentration of recombinant proteins is measured using absorbance at 280nm .

Functional Studies

Studies on recombinant mouse Nat14 (or its homologues) have provided insights into its enzymatic properties and potential roles .

  • Substrate Specificity: Mouse Nat2 (the mouse equivalent of human NAT1) shows high activity with arylamines like PABA, 5AS, 4AS, and 2AF, but low activity against arylhydrazines and arylamine drugs .

  • Inhibition: Compounds like tamoxifen, genistein, and diethylstilbestrol can inhibit mouse Nat2 activity .

  • Comparison to Human NAT1: Mouse Nat2 and human NAT1 share similar substrate specificity profiles, with mouse Nat2 generally showing higher inherent activity .

Relevance to Disease

Research suggests Nat14's involvement in disease mechanisms . Human arylamine N-acetyltransferase type 1 (NAT1), which is similar to mouse Nat2, appears to be a marker in human estrogen receptor-positive breast cancer .

Data Tables

The tables showcase the characteristics of recombinant mouse Netrin-4 protein, not recombinant mouse NAT14, due to the available data .

FeatureDescription
ProteinMouse Netrin-4
SourceRecombinant
Binding ActivityBinds rrUNC5H2/Fc Chimera in a functional ELISA with a linear range of 6-400 ng/mL when rrUNC5H2/Fc Chimera is immobilized at 5 µg/mL (100 µL/well)
Amino Acid SequenceLeu19-Val628 & Ala26-Val628, both with a C-terminal 10-His tag
FormulationLyophilized from a 0.2 μm filtered solution in PBS with BSA as a carrier protein
ReconstitutionReconstitute at 100 μg/mL in sterile PBS containing at least 0.1% human or bovine serum albumin
ShippingAmbient temperature
StabilityUse a manual defrost freezer and avoid repeated freeze-thaw cycles

Research Findings

  • NAT14 in Human Cells: In human cells, NAT14 is located on chromosome 19 .

  • NAT14 Function: Although NAT14 was initially thought to catalyze the synthesis of NAA from L-aspartate and acetyl-CoA, research indicates that NAT8L, not NAT14, performs this function .

  • Inhibitor Discovery: Structure-guided design and synthesis have led to the development of Nsp14 methyltransferase inhibitors, which target both SAM and mRNA-binding pockets .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Nat14; Probable N-acetyltransferase 14
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-206
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MAPNHLSVREMREDEKPLVLEMLKAGVKDTENRVALHALTRPPALLLLAAASSGLRFILA SFALALLLPVFLAVAAVKLGLRARWGSLPPPGGLGGPWVAVRGSGDVCGVLALAPGANVG DGARVTRLSVSRWHRRRGVGRRLLAFAEARARAWAGSMGEPRARLVVPVAVAAWGVAGLL EACGYQAEGGWGCMGYMLVREFSKDL
Uniprot No.

Target Background

Function
Recombinant Mouse N-acetyltransferase 14 (Nat14) is a probable acetyltransferase that binds the 5'-GGACTACAG-3' sequence of the coproporphyrinogen oxidase promoter. It exhibits in vitro transcriptional activation of a reporter construct. Nat14 may function as a transcription factor regulating coproporphyrinogen oxidase expression via binding to a promoter regulatory element.
Database Links

KEGG: mmu:269854

UniGene: Mm.42652

Protein Families
Camello family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is N-acetyltransferase 14 (Nat14) and what is its function in mice?

N-acetyltransferase 14 (Nat14) is a GCN5-related putative acetyltransferase enzyme that belongs to the broader N-acetyltransferase family. While specific functions of mouse Nat14 are still being elucidated, N-acetyltransferases generally catalyze the transfer of acetyl groups from acetyl-CoA to the terminal nitrogen of various substrates. Based on homology with human NAT14, mouse Nat14 likely plays roles in cellular acetylation pathways, potentially affecting protein function, stability, and localization. Unlike the better characterized mouse Nat2 (homologue of human NAT1), which has established roles in folate catabolism and has been linked to breast cancer research, mouse Nat14's specific physiological functions require further investigation .

How do expression systems for recombinant mouse Nat14 compare to those used for other mouse N-acetyltransferases?

Several expression systems have been successfully employed for recombinant N-acetyltransferases, with each offering distinct advantages depending on research objectives. For mouse N-acetyltransferases like Nat2, bacterial expression systems using E. coli have proven effective, though protein solubility can be challenging. Based on studies with related proteins, wheat germ cell-free expression systems offer advantages for producing challenging mammalian proteins with proper folding and minimal aggregation, as demonstrated with human NAT14 . For mouse Nat14 specifically, mammalian expression systems like HEK-293 cells may prove advantageous when post-translational modifications are critical, as suggested by the brief mention of mouse Nat14 production in HEK-293 cells . When studying enzymatic activity, it's crucial to consider that expression system choice may affect protein folding and activity.

What purification strategies are most effective for recombinant mouse Nat14?

Affinity purification using fusion tags represents the most straightforward approach for mouse Nat14 purification. GST-tagging has been successfully employed for human NAT14 expression and purification , making it a reasonable starting point for mouse Nat14. The GST tag facilitates both purification and detection while potentially enhancing solubility. Alternative tags like His-tags, mentioned in relation to mouse Nat14 , offer advantages for metal affinity chromatography purification. When designing a purification strategy, consider tag position carefully, as N-terminal tags may be preferable based on the protein structure. For optimal purity, incorporate secondary purification steps such as ion exchange or size exclusion chromatography after initial affinity purification. Importantly, verify that the chosen tag doesn't interfere with Nat14 enzymatic activity through comparative activity assays with tag-cleaved protein.

How can researchers design experiments to characterize substrate specificity of mouse Nat14?

Characterizing the substrate specificity of mouse Nat14 requires a systematic approach similar to that used for other N-acetyltransferases. Begin with a broad substrate screening panel including various primary amines, as N-acetyltransferases typically acetylate primary amino groups. Based on approaches used with mouse Nat2, develop a spectrophotometric assay measuring the rate of acetylation by detecting either the acetylated product or the release of free CoA following acetyl transfer . For detailed analysis, employ HPLC methods to separate and quantify acetylated products, allowing precise determination of kinetic parameters (KM, Vmax).

For structure-activity relationship studies, test structurally related compounds to identify key molecular features required for substrate recognition. Additionally, NMR spectroscopy can provide valuable insights into substrate binding, as demonstrated with mouse Nat2, where NMR revealed binding interactions through shifts in proton peaks . When comparing mouse Nat14 to human NAT14, use identical experimental conditions to identify species-specific differences in substrate preferences. Finally, validate in vitro findings through cellular assays using mouse cell lines expressing Nat14 to confirm physiologically relevant substrates.

What structural analysis techniques provide the most valuable insights for mouse Nat14 research?

Multiple complementary structural analysis techniques offer valuable insights into mouse Nat14 structure and function. X-ray crystallography represents the gold standard for obtaining high-resolution three-dimensional structures, though crystallization of mouse Nat14 may be challenging. NMR spectroscopy provides an excellent alternative, particularly for investigating protein-ligand interactions in solution, as demonstrated with related N-acetyltransferases. For mouse Nat2, 15N-labeling enabled 2D NMR investigations of protein-inhibitor interactions, revealing important binding information through chemical shift perturbations .

Homology modeling represents a practical approach when crystallographic data is unavailable, as demonstrated in studies where human NAT1 crystal structures were used to generate models of mouse Nat2 . Similar approaches could be applied to mouse Nat14 using human NAT14 as a template. For dynamics studies, hydrogen-deuterium exchange mass spectrometry (HDX-MS) can reveal regions of flexibility and conformational changes upon substrate binding. When studying domain organization, limited proteolysis coupled with mass spectrometry helps identify stable structural domains. Finally, circular dichroism spectroscopy provides valuable information about secondary structure content and thermal stability of recombinant Nat14.

How can researchers develop specific inhibitors for mouse Nat14?

Developing specific inhibitors for mouse Nat14 requires a systematic approach integrating structural information, screening methodologies, and validation strategies. Begin with structural analysis to identify potential binding pockets, similar to approaches used for mouse Nat2 where NMR spectroscopy revealed that bisphenol A binds close to the active site . If mouse Nat14 has significant homology to human NAT14, leverage existing human NAT14 structural data to identify conserved regions suitable for inhibitor targeting.

Establish a robust high-throughput screening assay measuring Nat14 enzymatic activity to evaluate compound libraries. Screening diverse compound libraries has proven successful for identifying inhibitors of related N-acetyltransferases, as demonstrated by the identification of potent and specific inhibitors for human NAT1 and mouse Nat2 through screening of 5000 compounds . Structure-activity relationship studies of initial hits will guide optimization for potency and selectivity.

Assess inhibitor specificity by testing against other mouse N-acetyltransferases and the human NAT14 homolog. For promising compounds, perform detailed binding mechanism studies using NMR spectroscopy or isothermal titration calorimetry to determine binding constants and thermodynamic parameters. Finally, validate inhibitors in cellular systems expressing mouse Nat14 to confirm efficacy in a more physiological context.

What methods are most effective for identifying protein-protein interactions of mouse Nat14?

Multiple complementary approaches can effectively identify protein-protein interactions of mouse Nat14. Co-immunoprecipitation using antibodies against endogenous mouse Nat14 or epitope tags on recombinant protein represents a straightforward approach for identifying physiologically relevant interacting partners from mouse tissue or cell lysates. This approach successfully identified interactions between Rai14 and Tara in mouse brain lysates .

Yeast two-hybrid screening provides an unbiased approach for discovering novel interaction partners, as demonstrated for Rai14 and Tara . For comprehensive interactome analysis, proximity-dependent biotin identification (BioID) or APEX2 proximity labeling coupled with mass spectrometry can identify proteins in close proximity to Nat14 in living cells. Pull-down assays using purified recombinant GST-tagged mouse Nat14 can verify direct interactions and determine binding affinities.

For detailed characterization of identified interactions, FRET or BRET assays enable real-time monitoring of protein interactions in living cells. Domain mapping experiments, similar to those performed for Rai14-Tara interaction , can identify specific regions responsible for protein binding. Finally, validate biologically significant interactions through functional studies examining how disruption of the interaction affects Nat14 activity, stability, or localization.

How does mouse Nat14 interact with potential binding partners, and what techniques can elucidate these interactions?

Understanding mouse Nat14 interactions with binding partners requires investigation of both physical association and functional consequences. While specific mouse Nat14 interaction data is limited, studies of related proteins provide valuable methodological guidance. For physical interaction characterization, perform co-immunoprecipitation experiments in mouse tissues or transfected cells to identify endogenous or overexpressed binding partners . Domain mapping through deletion mutant analysis, as demonstrated for Rai14-Tara interaction, helps identify specific binding interfaces .

For detailed mechanistic understanding, examine how interactions affect Nat14 stability, activity, or localization. The Rai14-Tara interaction provides an instructive example, where Tara protected Rai14 from degradation through complex formation . Similar protection mechanisms might apply to mouse Nat14. To determine if interactions affect Nat14 enzymatic activity, compare activity measurements of Nat14 alone versus Nat14 in complex with binding partners.

Fluorescence microscopy with co-localization analysis can reveal subcellular compartments where interactions occur. For dynamic studies, fluorescence recovery after photobleaching (FRAP) or fluorescence correlation spectroscopy (FCS) can measure how interactions affect protein mobility. Finally, examine how physiological or pathological conditions affect these interactions to understand their context-dependent regulation.

How should researchers address expression and solubility challenges with recombinant mouse Nat14?

Addressing expression and solubility challenges with recombinant mouse Nat14 requires a systematic troubleshooting approach. If bacterial expression yields insoluble protein, optimize induction conditions by reducing temperature (16-20°C), decreasing IPTG concentration, or using auto-induction media. Solubility-enhancing fusion partners like GST, MBP, or SUMO can dramatically improve solubility, as demonstrated by successful GST-tagging of human NAT14 .

For persistent solubility issues, consider alternative expression systems. Wheat germ cell-free expression systems have proven effective for human NAT14 and may work well for mouse Nat14. For mammalian expression, HEK-293 cells have been used successfully for mouse Nat14 production . When protein remains insoluble across systems, explore protein refolding strategies from inclusion bodies or consider expressing individual domains rather than the full-length protein.

Buffer optimization is critical for maintaining solubility during purification. Screen buffers varying in pH (6.5-8.5), salt concentration (100-500 mM NaCl), and additives (glycerol, reducing agents). Detergents may help if hydrophobic regions contribute to aggregation. For structural studies requiring high protein concentrations, additives like arginine and glutamic acid can prevent aggregation. Finally, protein storage conditions significantly impact long-term stability—test cryoprotectants like glycerol or sucrose and assess stability at different temperatures (-80°C, -20°C, 4°C).

How can researchers interpret contradictory results between in vitro and in vivo mouse Nat14 studies?

Interpreting contradictory results between in vitro and in vivo mouse Nat14 studies requires careful consideration of multiple factors. Begin by examining differences in experimental conditions: in vitro studies typically use purified recombinant protein in defined buffer conditions, while in vivo environments include cellular cofactors, post-translational modifications, and compartmentalization that may alter activity or specificity. For example, interactions with binding partners like those observed between Rai14 and Tara can significantly affect protein stability and function in vivo .

Post-translational modifications present in vivo but absent in recombinant systems may explain functional differences. Check if your recombinant Nat14 lacks critical modifications by comparing mass spectrometry profiles of native versus recombinant protein. Additionally, protein folding differences between expression systems can affect activity, as observed with other N-acetyltransferases .

Cellular compartmentalization can create microenvironments with different pH, ion concentrations, or redox states that affect enzyme behavior. Verify the subcellular localization of Nat14 in your in vivo studies and attempt to mimic these conditions in vitro. For substrate availability differences, assess if physiological substrate concentrations match those used in vitro. Finally, consider using genetic approaches (knockout, knockdown, or overexpression) combined with rescue experiments using mutant variants to reconcile in vitro and in vivo observations.

What approaches can help validate the specificity of anti-mouse Nat14 antibodies?

Validating anti-mouse Nat14 antibody specificity is critical for reliable research outcomes. Begin with Western blot analysis comparing wild-type mouse tissues with Nat14 knockout or knockdown samples—a specific antibody should show significantly reduced or absent signal in knockout samples. When knockout models are unavailable, siRNA or shRNA knockdown in mouse cell lines provides an alternative negative control.

Perform immunoprecipitation followed by mass spectrometry to confirm that the antibody pulls down Nat14 rather than cross-reactive proteins. For antibodies against recombinant mouse Nat14, pre-absorption with purified antigen should eliminate specific binding, while pre-absorption with irrelevant proteins should not affect binding.

Evaluate cross-reactivity with related N-acetyltransferases by testing the antibody against purified recombinant proteins from the same family. Immunofluorescence specificity can be confirmed by comparing staining patterns with those of GFP-tagged Nat14 and by demonstrating signal reduction after Nat14 knockdown. Finally, for critical applications, use multiple antibodies targeting different epitopes of Nat14—consistent results across different antibodies strongly support specificity.

How can researchers develop and validate mouse models for studying Nat14 function?

Developing mouse models for studying Nat14 function requires careful planning and validation. For knockout models, CRISPR/Cas9 gene editing offers an efficient approach to generate complete Nat14 knockout mice. Design guide RNAs targeting early exons to create frameshift mutations, similar to approaches used for other genes like Rai14, where knockout mice exhibited specific phenotypes related to dendritic spine density .

For conditional knockout models, use Cre-loxP systems to enable tissue-specific or inducible Nat14 deletion, allowing investigation of tissue-specific functions while avoiding potential embryonic lethality of complete knockouts. When subtle modifications are needed, knock-in approaches can introduce point mutations to study specific functional domains or create reporter fusions for tracking Nat14 expression and localization.

Thoroughly validate generated models through genomic DNA sequencing to confirm intended mutations, RT-PCR and Western blotting to verify altered expression, and immunohistochemistry to examine tissue-specific expression patterns. Comprehensive phenotypic characterization should include behavioral assessments, histological examination of multiple tissues, and molecular analyses of potential compensatory mechanisms. For genetic background effects, consider backcrossing to established inbred strains, as genetic background can significantly influence phenotypes, as observed with Nat2 deletion studies showing genetic background-dependent effects on sex ratios .

What experimental designs best elucidate the physiological roles of mouse Nat14 in different tissues?

Elucidating the physiological roles of mouse Nat14 across different tissues requires complementary experimental approaches. Begin with comprehensive tissue expression profiling using qRT-PCR, Western blotting, and immunohistochemistry to identify tissues with high Nat14 expression. RNA-seq analysis comparing wild-type and Nat14-deficient tissues can reveal gene expression changes that provide clues to Nat14's regulatory networks.

For tissue-specific functions, conditional knockout models using tissue-specific Cre lines allow targeted Nat14 deletion while avoiding potential developmental effects of constitutive knockouts. Cell type-specific isolation techniques like laser capture microdissection or FACS sorting of specific cell populations enable precise analysis of Nat14 function in distinct cell types within complex tissues.

Design functional assays relevant to the tissue of interest—for neural tissues, examine dendritic spine density and electrophysiological properties, similar to studies performed with Rai14 . For potential roles in cancer biology, examine cell proliferation, migration, and resistance to apoptosis in relevant cell types, drawing parallels from studies of NAT1/Nat2 in breast cancer models . Metabolomic profiling comparing wild-type and Nat14-deficient tissues can identify metabolic pathways affected by Nat14 activity. Finally, examine how physiological stressors or disease models affect Nat14 expression and function to understand its roles in pathological conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.