Recombinant Mouse N-acetyltransferase 8 (Nat8)

Shipped with Ice Packs
In Stock

Description

General Information

N-Acetyltransferase 8 (NAT8), also known as ATase2, is an enzyme involved in the Nε-lysine acetylation of nascent glycoproteins within the endoplasmic reticulum (ER) lumen, which regulates the efficiency of the secretory pathway . NAT8 is suggested to play a role in detoxification processes by catalyzing the acetylation of cysteine conjugates to form mercapturic acids, which can be excreted in bile and urine .

Gene and Protein Characteristics

  • NAT8 is a protein-coding gene .

  • It is specifically expressed in the liver and kidney .

  • NAT8 is located at the cytogenetic band 4p16.3 .

  • Two acetyltransferases, ATase1/NAT8B and ATase2/NAT8, carry out the enzymatic reaction within the ER lumen .

  • The promoter region, defined as the sequence from the transcriptional start site (+1) to 1,000 bases upstream, was analyzed from the human genes SLC33A1 (Gene ID 9197), NAT8B (Gene ID 51471), and NAT8 (Gene ID 9027) using the GRCh38.p12 genome assembly sequence .

Role in Disease

  • Dysfunctional ER acetylation is associated with severe neurological diseases with duplication .

  • NAT8 gene variants are associated with N-acetylated amino acids, some of which have circulating levels associated with kidney failure .

  • Variants in the promotor region of NAT8 have shown protective effects against hypertension and kidney failure .

  • Diseases associated with NAT8 include Xia-Gibbs Syndrome and Iminoglycinuria .

NAT8-Like (NAT8L) in Cancer

  • N-Acetyltransferase 8 Like (NAT8L) inhibits natural killer (NK)/T-cell cytotoxicity by impairing the formation of the immunological synapse via N-acetylaspartate (NAA) .

  • NAT8L expression was upregulated in 6 cancers and downregulated in 12 compared to normal tissues .

  • NAT8L may serve as a potential prognostic marker and therapeutic target across a variety of cancers, particularly in kidney renal papillary cell carcinoma (KIRP), colon adenocarcinoma (COAD), and lung squamous cell carcinoma (LUSC) .

  • Silencing NAT8L inhibits the growth of various human cancerous and non-cancerous cell lines .

  • NAT8L exhibits a positive correlation with most immunomodulatory genes across COAD, COADREAD, and PAAD .

Functional Studies

  • Recombinant Mouse Wnt-8a stimulates alkaline phosphatase production by C3H10T1/2 mouse embryonic fibroblast cells . The ED50 for this effect is 0.5-2.5 μg/mL .

    AssayED50 Range
    Alkaline phosphatase production by C3H10T1/2 cells0.5-2.5 μg/mL
  • SDS-PAGE analysis of Recombinant Mouse Wnt-8a shows bands at 42.3 and 38.9 kDa under reducing and non-reducing conditions, respectively .

    ConditionBand Size (kDa)
    Reducing42.3
    Non-reducing38.9

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If a specific tag type is required, please inform us for preferential development.
Synonyms
Nat8; Cml4; N-acetyltransferase 8; Acetyltransferase 2; ATase2; Camello-like protein 4; Cysteinyl-conjugate N-acetyltransferase; CCNAT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Nat8
Target Protein Sequence
MASFRIRQFQERDYKQVVDVFSRGMEEHIPTAFRHLLTLPRTLLLLAVVPLAIVLVSGSW FLAVVCIFFLFLFLWFLASKPWKNYVSKCLHTDMADITKSYLSVRGSGFWVAESGGQVVG TVAARPVKDPPLGRKQLQLFRLSVSSQHRGQGIAKALTRTVLQFARDQGYSDVVLVTGLL QQGAVTLYYSMGFQKTGESFVDILTWLVDVSLIHFIYPLPSAQKYEL
Uniprot No.

Target Background

Function
This recombinant mouse N-acetyltransferase 8 (Nat8) acetylates the free alpha-amino group of cysteine S-conjugates, forming mercapturic acids. This enzyme catalyzes the final step in a major detoxification pathway for various reactive electrophiles. This pathway begins with glutathione S-conjugate formation, followed by processing into cysteine S-conjugates, and finally, the formation of water-soluble mercapturic acids readily excreted in urine or bile. Nat8 may also exhibit lysine N-acetyltransferase activity, catalyzing peptidyl-lysine N6-acetylation in various proteins. This activity potentially regulates apoptosis through the acetylation and expression modulation of PROM1. Additionally, Nat8 may regulate amyloid beta-peptide secretion via acetylation of BACE1 and the regulation of its expression in neurons.
Gene References Into Functions
  1. Studies indicate that Nat8 is downregulated in liver ischemia/reperfusion injury, and its upregulation demonstrates a protective effect against liver damage. PMID: 25057902
Database Links
Protein Families
Camello family
Subcellular Location
Endoplasmic reticulum-Golgi intermediate compartment membrane; Single-pass type II membrane protein. Endoplasmic reticulum membrane; Single-pass type II membrane protein.
Tissue Specificity
Expressed in brain (at protein level).

Q&A

What is N-acetyltransferase 8 (Nat8) and what is its primary function?

N-acetyltransferase 8 (Nat8) is an endoplasmic reticulum-resident acetyltransferase that transfers acetyl groups from a donor (acetyl-CoA) to specific acceptor molecules . While it shares homology with other acetyltransferases like NAT8L (which produces N-acetylaspartate in the brain), Nat8 serves a distinct function in xenobiotic metabolism . The primary biochemical function of Nat8 has been identified as a cysteinyl-S-conjugate N-acetyltransferase, which catalyzes the final step in mercapturic acid formation . This activity plays a crucial role in the biotransformation and detoxification of various xenobiotic compounds and their metabolites. Unlike related N-acetyltransferases that act on a broad spectrum of substrates, Nat8 demonstrates significant specificity toward cysteine conjugates, highlighting its specialized role in detoxification pathways.

Where is Nat8 primarily expressed in mammals?

Nat8 exhibits a highly tissue-specific expression pattern in mammals. Research has demonstrated that Nat8 is almost exclusively expressed in the kidney and liver, which aligns with its function in xenobiotic metabolism and detoxification . This restricted expression pattern distinguishes it from some other acetyltransferases that may show broader tissue distribution. The tissue specificity is particularly significant for researchers designing tissue-specific studies or considering the physiological relevance of Nat8 in different experimental models. The concentrated expression in metabolic and excretory organs supports its role in detoxification processes and suggests that studies focused on these tissues will be most physiologically relevant when investigating Nat8 function in vivo.

What is the subcellular localization of Nat8?

Nat8 is predominantly localized to the endoplasmic reticulum (ER) . Subcellular localization studies using immunofluorescence microscopy with His-tagged or Myc-tagged Nat8 constructs have confirmed this ER association . The protein partly delineates the nuclear envelope and extends into the cytoplasm with the characteristic reticular pattern of the ER . Continuities with the nuclear envelope have been observed, and partial co-localization with KDEL-bearing ER proteins has been demonstrated . Importantly, Nat8 shows complete segregation from the Golgi complex (as identified by GM130 immunolabeling) and from mitochondria (labeled with MitoTracker red) . This specific subcellular localization is consistent with its role in processing xenobiotics and its involvement in cellular detoxification pathways that are often initiated in the ER.

How are Nat8 enzymatic activities measured in vitro?

The enzymatic activity of Nat8 can be measured using several complementary approaches. The primary method utilizes a spectrophotometric assay based on the reaction of 5,5′-dithiobis-(2-nitrobenzoic acid) (DTNB) with the free CoASH produced during the acetylation reaction . In this approach, the N-acetyltransferase activity is determined by comparing the formation of free CoASH from acetyl-CoA in the absence and presence of potential substrates . After incubation (typically 10 minutes at 37°C), addition of DTNB results in a stoichiometric increase of absorbance at 412 nm due to its reaction with free CoASH . For confirming the identity of reaction products, researchers can employ reverse-phase HPLC separation followed by mass spectrometry analysis . Additionally, for specific substrates like LTE4, radiochemical assays using [acetyl-³H]CoA may be employed to detect the very low levels of activity .

What are the known substrates of Nat8?

The substrate specificity of Nat8 has been characterized through systematic evaluation of potential acceptor molecules. The primary substrates identified include:

  • S-benzyl-L-cysteine: This model cysteine conjugate is efficiently acetylated by Nat8 with a Km of 64 ± 16 μM and Vmax of 4.4 ± 0.3 nmol·min⁻¹·mg⁻¹ protein (in the presence of 0.2 mM acetyl-CoA) .

  • Leukotriene E4 (LTE4): This cysteinyl-S-conjugate is acetylated by Nat8, though at a significantly lower rate (approximately 100-fold lower) than S-benzyl-L-cysteine under comparable conditions .

Notably, Nat8 shows high substrate specificity and does not significantly acetylate other amino acids or compounds tested, including L-aspartate, L-lysine (either free or blocked on α- or ε-amines), L-cystine, L-methionine, L-ethionine, L-cystathionine, or aromatic amino acids (L-phenylalanine, L-tyrosine, and L-tryptophan) . This substrate specificity distinguishes Nat8 from NAT8L, which acetylates L-aspartate but does not act on cysteine conjugates like S-benzyl-L-cysteine .

How does Nat8 contribute to viral replication mechanisms?

Nat8 has been identified as a host factor for enterovirus 71 (EV71) infection, playing a critical role in viral replication . EV71 is one of the most common pathogens causing hand, foot, and mouth disease (HFMD) in young children, sometimes with severe neurological consequences . Mechanistically, Nat8 promotes viral replication in an acetyltransferase-activity-dependent manner . The protein facilitates EV71 infection through direct interactions with several viral proteins, specifically EV71 2B, 3AB, and 3C proteins . These interactions increase the stability of these viral proteins, which is essential for effective viral replication . In the absence of Nat8, EV71 fails to complete its infection cycle in various cell types, indicating that the virus hijacks this host factor for its benefit . This mechanism represents a novel function of Nat8 beyond its established role in xenobiotic metabolism and highlights a potential target for antiviral interventions.

What are the effects of key mutations on Nat8 enzymatic activity?

Several naturally occurring and experimentally introduced mutations have been studied to understand structure-function relationships in Nat8:

  • Common single nucleotide polymorphisms (SNPs) E104K and F143S: These frequent variants do not significantly alter enzymatic activity or protein expression (changes are less than 2-fold) . This suggests that these positions are not critical for the catalytic function or structural stability of Nat8.

  • R149K mutation: Replacement of the extremely conserved arginine at position 149 with lysine results in suppression of enzymatic activity . This finding identifies R149 as a critical residue for Nat8 function, likely involved in substrate binding or catalysis.

  • Truncation mutations: Truncated NAT8 proteins starting from Met-25 (similar to the naturally truncated NAT8B) show no cysteinyl-S-conjugate N-acetyltransferase activity . This indicates that the N-terminal region of Nat8 is essential for proper enzymatic function.

These mutation studies provide valuable insights into the structural determinants of Nat8 activity and can guide future efforts in protein engineering or inhibitor design.

What is the relationship between Nat8 and mercapturic acid formation?

Nat8 has been identified as the enzyme responsible for catalyzing the final step in mercapturic acid formation . Mercapturic acids are N-acetylated cysteine S-conjugates that represent important detoxification products formed from various xenobiotics. The pathway involves several steps:

  • Initially, electrophilic compounds are conjugated to glutathione (GSH) via glutathione S-transferases

  • The glutathione conjugates are then processed by removing glutamate and glycine

  • The resulting cysteine S-conjugates are finally N-acetylated by Nat8 to form mercapturic acids

This N-acetylation step enhances the water solubility of these compounds, facilitating their excretion in urine. The identification of Nat8 as the microsomal enzyme responsible for this crucial biotransformation step resolves a long-standing question in xenobiotic metabolism research . The highly specific expression of Nat8 in kidney and liver aligns perfectly with its role in detoxification, as these organs are central to xenobiotic processing and elimination from the body.

How do researchers study Nat8 interactions with viral proteins?

When investigating Nat8 interactions with viral proteins such as EV71 2B, 3AB, and 3C proteins, researchers employ several complementary approaches:

  • Co-immunoprecipitation (Co-IP) assays: These can be used to detect physical interactions between Nat8 and viral proteins in cell lysates .

  • Fusion protein systems: Expression of tagged versions of both Nat8 and viral proteins allows for pull-down assays to confirm direct interactions.

  • Protein stability assays: Since Nat8 has been shown to increase the stability of viral proteins, pulse-chase experiments using cycloheximide can be employed to measure protein half-life in the presence or absence of Nat8 .

  • Functional assays: Researchers can assess viral replication efficiency in cells with normal, overexpressed, or knocked-down Nat8 using techniques such as plaque assays, viral RNA quantification, or reporter systems .

  • Mutagenesis studies: Creating mutations in either Nat8 or viral proteins can help identify specific domains or residues critical for the interaction, distinguishing between catalytic activity-dependent and independent effects.

These techniques provide a comprehensive toolkit for dissecting the molecular basis of Nat8-virus interactions and can reveal potential targets for therapeutic intervention.

What approaches can be used to modulate Nat8 activity in cellular systems?

Several approaches can be employed to modulate Nat8 activity in experimental systems:

  • CRISPR/Cas9 gene editing: This technology can be used to create Nat8 knockout cell lines, allowing for loss-of-function studies .

  • RNA interference (RNAi): siRNA or shRNA targeting Nat8 mRNA can be used for transient or stable knockdown of Nat8 expression.

  • Small molecule inhibitors: Compounds that inhibit Nat8 acetyltransferase activity can be developed and employed for acute inhibition studies .

  • Overexpression systems: Transfection with plasmids encoding wild-type or mutant Nat8 can be used to study gain-of-function effects .

  • Inducible expression systems: These allow for temporal control of Nat8 expression, useful for studying dose-dependent effects or avoiding potential cytotoxicity associated with constitutive overexpression .

Each approach has specific advantages and limitations, and researchers should select the most appropriate method based on their experimental goals and cellular system.

What are the recommended methods for expressing recombinant Nat8?

For successful expression of recombinant Nat8, several methodological considerations are important:

  • Expression vectors: Plasmids containing strong promoters (such as pEF6) have been successfully used for mammalian expression of Nat8 .

  • Tagging strategies: Both N-terminal and C-terminal His6-tagged versions of Nat8 have been shown to retain enzymatic activity . Myc-tagged versions can also be employed, particularly for immunofluorescence studies .

  • Cell lines: HEK293T cells have been successfully used for expression of recombinant Nat8 . Chinese hamster ovary (CHO) cells have also been employed, particularly for subcellular localization studies .

  • Transfection methods: Lipid-based transfection reagents such as jetPEI have been effectively used for Nat8 expression .

  • Expression verification: Western blot analysis using anti-His or anti-Myc antibodies can confirm expression of tagged Nat8 proteins .

It's important to note that Nat8 expression has been associated with some degree of cytotoxicity, which should be taken into consideration when designing expression experiments . Controlling expression levels through inducible systems or optimizing harvest times may help mitigate this issue.

How can subcellular localization of Nat8 be studied?

Investigating the subcellular localization of Nat8 can be accomplished through several complementary approaches:

  • Immunofluorescence microscopy: This is the primary method used to visualize Nat8 localization. Cells are transfected with tagged Nat8 constructs (His- or Myc-tagged), fixed, and subjected to immunolabeling using appropriate antibodies against the tag .

  • Co-localization studies: Double immunolabeling with markers for specific cellular compartments can precisely define Nat8 localization. Common markers include:

    • KDEL-bearing proteins for ER

    • GM130 for Golgi complex

    • MitoTracker red for mitochondria

  • Cell fractionation: Biochemical separation of cellular compartments followed by Western blotting can provide complementary evidence for Nat8 localization.

  • Electron microscopy: For higher resolution analyses, immunogold labeling combined with electron microscopy can precisely locate Nat8 within cellular structures.

  • Live-cell imaging: For dynamic studies, fluorescent protein fusions (e.g., GFP-Nat8) can be used to monitor localization in living cells.

These approaches have confirmed that Nat8 localizes to the endoplasmic reticulum, with characteristic patterns including nuclear envelope delineation and cytoplasmic reticular distribution .

What methods are used to analyze the reaction products of Nat8?

The analysis of Nat8 reaction products requires sophisticated analytical techniques:

  • Reverse-phase HPLC: This is a primary method for separating and identifying Nat8 reaction products. For example, N-acetyl-S-benzylcysteine (produced from S-benzyl-L-cysteine) can be separated using a DeltaPak C18 column with a linear gradient of acetonitrile in water containing 0.1% trifluoroacetic acid .

  • Mass spectrometry: LC-MS/MS analysis is essential for confirming the identity of reaction products. In published studies, an LCQ Deca XP ion-trap spectrometer equipped with an electrospray ionization source has been used for this purpose . Tandem mass spectrometry with low-energy collision-induced dissociation can confirm the structure of precursor ions .

  • Radiochemical assays: For substrates with low turnover rates (like LTE4), radiochemical assays using [acetyl-³H]CoA provide the sensitivity needed to detect product formation .

  • Spectrophotometric assays: These are useful for kinetic studies, where the release of CoASH during the reaction is monitored using DTNB, which reacts with the thiol group to form a colored product measurable at 412 nm .

These analytical methods provide complementary information about the specificity, efficiency, and products of Nat8-catalyzed reactions.

How can researchers assess the cytotoxicity associated with Nat8 expression?

Several methods can be employed to quantify and characterize the cytotoxicity associated with Nat8 expression:

  • Lactate dehydrogenase (LDH) release assay: This approach measures the release of LDH into the culture medium as an indicator of cell membrane damage. The CytoTox-96 cytotoxicity assay has been specifically used to measure Nat8-associated cytotoxicity in transfected HEK293T cells .

  • MTT/MTS assays: These colorimetric assays assess metabolic activity and cell viability through measurement of mitochondrial reductase activity.

  • Flow cytometry: Annexin V/propidium iodide staining can be used to distinguish between apoptotic and necrotic cell death mechanisms.

  • Caspase activity assays: These can determine whether Nat8 expression triggers apoptotic pathways.

  • Dose-dependent expression studies: Using inducible expression systems can help establish the relationship between Nat8 expression levels and cytotoxicity.

These approaches can provide insights into both the extent and mechanism of Nat8-associated cytotoxicity, which has been observed in various experimental systems and was previously reported when mRNAs from human, mouse, or Xenopus NAT8 homologues were injected into Xenopus embryos .

How is Nat8 involved in viral infection mechanisms?

Nat8 plays a crucial role in facilitating enterovirus 71 (EV71) infection through specific mechanisms . EV71 is a significant pathogen causing hand, foot, and mouth disease (HFMD) in children, sometimes with severe neurological complications . Nat8 functions as a host factor that the virus hijacks to enhance its replication efficiency . Mechanistically, Nat8 interacts directly with several non-structural viral proteins, specifically EV71 2B, 3AB, and 3C proteins . These interactions result in increased stability of these viral proteins, which is essential for effective viral replication . The process is dependent on the acetyltransferase activity of Nat8, suggesting that acetylation of viral or host proteins may be involved . When Nat8 is inhibited through CRISPR knockout or small molecule inhibitors, EV71 infection is significantly suppressed in various cell types, including neuroblastoma SK-N-SH cells . This finding establishes Nat8 as a potential therapeutic target for treating or preventing EV71 infections.

What is known about Nat8 homologs across different species?

Nat8 homologs are present across vertebrate genomes, though with interesting evolutionary patterns:

This evolutionary perspective provides valuable context for understanding Nat8 function and its specialization across different species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.