Recombinant Mouse N-arachidonyl glycine receptor (Gpr18)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Mouse N-Arachidonyl Glycine Receptor (Gpr18)

Recombinant Mouse N-arachidonyl glycine receptor (Gpr18) is a laboratory-engineered protein used to study the structure, signaling, and therapeutic potential of the endogenous GPR18 receptor. This recombinant variant enables precise experimental control in cellular and molecular studies, particularly for investigating lipid-mediated neurotransmission, immune modulation, and neuroprotection .

Expression Systems

Recombinant mouse Gpr18 is produced in multiple heterologous systems:

Host SystemPurityApplicationsKey Features
E. coli≥85% Binding assays, structural studiesCost-effective, high yield
HEK293≥85% Functional signaling studiesProper post-translational modifications
Cell-Free≥85% Rapid productionAvoids host-cell contaminants

Neuroprotective Roles

  • Excitotoxicity Models: NAGly (the endogenous ligand) reduces neuronal damage in NMDA-lesioned organotypic hippocampal slice cultures (OHSC) by 40–60%. This effect is abolished by GPR18 antagonists .

  • Glial Modulation: Recombinant Gpr18 activation in primary astrocytes and microglia reduces pro-inflammatory activation markers (e.g., GFAP) .

Immune Regulation

  • T Cell Modulation: Gpr18 signaling via NAGly suppresses IFNγ and IL-17 secretion in CD4+ T cells by inhibiting mTORC1 pathways, suggesting anti-inflammatory therapeutic potential .

  • Microglial Migration: NAGly-Gpr18 interactions direct microglial motility in CNS injury models .

Experimental Use Cases

  • Ligand Binding Assays: Used to validate interactions with resolvin D2 (RvD2), Δ9-THC, and synthetic cannabinoids .

  • Signal Transduction Studies: Couples with Gαi/o and Gαq/11 pathways, influencing cAMP and calcium flux .

  • Neuroinflammation Models: Evaluated in ischemic brain injury and multiple sclerosis preclinical studies .

Limitations and Challenges

  • Constitutive Activity: Exhibits baseline signaling in vitro, complicating antagonist studies .

  • Antibody Specificity: Commercially available antibodies (e.g., Rabbit pAb) require validation using Gpr18-knockout controls .

Therapeutic Relevance

  • Neurodegenerative Diseases: Promotes neuronal survival in excitotoxic and inflammatory contexts .

  • Metabolic Disorders: Linked to omega-3 fatty acid pathways via RvD2-Gpr18 interactions, offering routes for metabolic inflammation modulation .

  • Pain Management: Emerging target for cannabinoid-adjacent therapies due to overlapping ligand profiles with CB1/CB2 receptors .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Gpr18; N-arachidonyl glycine receptor; NAGly receptor; G-protein coupled receptor 18
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-331
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MATLSNHNQLDLSNGSHPEEYKIAALVFYSCIFLIGLFVNVTALWVFSCTTKKRTTVTIY MMNVALLDLVFILSLPFRMFYYAKGEWPFGEYFCHILGALVVFYPSLALWLLAFISADRY MAIVQPKYAKELKNTGKAVLACGGVWVMTLTTTVPLLLLYEDPDKASSPATCLKISDITH LKAVNVLNFTRLIFFFLIPLFIMIGCYVVIIHSLLRGQTSKLKPKVKEKSIRIIMTLLLQ VLVCFVPFHICFAVLMLQGQENSYSPWGAFTTFLMNLSTCLDVVLYYIVSKQFQARVISV MLYRNYLRSVRRKSVRSGSLRSLSNMNSEML
Uniprot No.

Target Background

Function
The recombinant mouse N-arachidonyl glycine receptor (GPR18) is a receptor for the endocannabinoid N-arachidonyl glycine (NAGly). While its role as a NAGly agonist is debated, GPR18 is also activated by plant-derived and synthetic cannabinoid agonists. Its activity is mediated by G proteins that inhibit adenylyl cyclase. GPR18 contributes to immune system regulation and is crucial for maintaining the homeostasis of CD8+ intraepithelial lymphocytes (IELs) (CD8αα and CD8αβ IELs) in the small intestine. Specifically, it supports the preferential migration of CD8αα T-cells to the intraepithelial compartment over the lamina propria and mediates their reconstitution after bone marrow transplantation. GPR18 plays a role in hypotensive responses, reducing intraocular and blood pressure. Furthermore, it mediates NAGly-induced actin filament reorganization and acrosomal exocytosis.
Gene References Into Functions
  1. Our findings support FAAH-dependent NAGly action at GPR18 as the physiological basis for the diurnal variation of intraocular pressure in mice. PMID: 27893106
  2. GPR18 plays a role in the development and reconstitution of thymus-derived intestinal IEL subsets under steady-state conditions and after bone marrow transplantation. PMID: 26197390
  3. Evidence indicates that the orphan G-protein-coupled receptor GPR18 is required for the normal homeostasis of CD8αα γδT and αβT and CD8αβ intestinal intraepithelial lymphocyte compartments. PMID: 25348153
  4. Data, including those from knockout mice, suggest that GPR18 signal transduction in corneal and ciliary epithelium is essential for regulating intraocular pressure. PMID: 23461720
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle membrane.
Tissue Specificity
Expressed in the eye including cornea, retina, iris and ciliary epithelium (at protein level). Expressed in spleen, liver and lymphocytes with highest expression levels in intestinal intraepithelial lymphocytes.

Q&A

What is the physiological role of N-arachidonyl glycine (NAGly) in neural signaling?

NAGly functions as an endogenous lipid molecule with several important neurophysiological roles. Within the spinal cord, NAGly enhances inhibitory glycinergic synaptic transmission specifically in the superficial dorsal horn by blocking glycine uptake via the glycine transporter GLYT2 . This mechanism appears to be selective for GLYT2 rather than GLYT1, as supported by comparative studies with specific transporter inhibitors (ALX-1393 and ALX-5407) . Additionally, NAGly decreases excitatory NMDA-mediated synaptic transmission, providing a dual mechanism for its analgesic properties . In patch-clamp recordings from lamina II neurons, NAGly prolongs the decay phase of glycine receptor-mediated inhibitory postsynaptic currents, though to a lesser extent than specific glycine transporter inhibitors . These complementary mechanisms provide a cellular explanation for the spinal analgesic actions observed with NAGly administration.

How does GPR18 expression vary across different tissues and cell types?

GPR18 exhibits a distinctive tissue distribution pattern that suggests specialized physiological roles. The receptor mRNA is most abundantly expressed in the testis, spleen, lymph nodes, and peripheral blood leukocytes . Within the immune system, GPR18 shows particularly high expression in several human T-Cell lymphotrophic virus-transformed cell lines and primary human peripheral lymphocyte subsets . Notably, phytohaemagglutinin-activated CD4+ T-cells demonstrate especially robust GPR18 expression . Some studies have reported glial expression of GPR18, though with inconsistent findings - for example, while microglial BV-2 cells were reported to express functional GPR18 in some studies, follow-up RT-PCR screening has failed to detect GPR18 mRNA in these cells . Human glioblastoma cell lines of right-parietal (NZB11) and right temporal (NZB19) origin have been confirmed to express GPR18 mRNA alongside CB1 receptor mRNA, but not CB2 or GPR55 mRNA .

What are the recommended methodologies for studying GPR18 activation in cellular models?

Investigating GPR18 activation requires careful consideration of experimental systems and multiple readouts due to the complex pharmacology of this receptor. Several methodological approaches are recommended:

  • Multiple signaling pathway assessment: Given that GPR18 exhibits biased agonism, measure multiple downstream pathways including:

    • Calcium mobilization

    • ERK1/2 phosphorylation

    • β-arrestin recruitment using PathHunter® assays with enzyme complementation

    • MTORC1 signaling evaluation (monitoring phosphorylation of S6 and P70S6K)

  • Receptor expression verification: Always validate GPR18 expression in your cellular model by:

    • RT-PCR for mRNA expression

    • Surface receptor quantification using tagged constructs (such as HA-tagged GPR18)

    • Comparison of surface:internal receptor ratios

  • Controls for specificity: Include appropriate controls to confirm GPR18-specific effects:

    • Use Pertussis toxin to block Gαi/o-mediated signaling

    • Compare with structurally related but non-active lipids

    • Include both positive (known agonists) and negative controls

    • Employ genetic knockout or knockdown approaches when feasible

When generating recombinant expression systems, preprolactin signal sequence and HA-tag additions may enhance surface expression, though homogeneous expression remains challenging even with Flp-in systems .

How can researchers address the controversies surrounding GPR18 as a cannabinoid receptor?

The classification of GPR18 as a cannabinoid receptor remains controversial due to conflicting experimental evidence. To address these controversies, researchers should implement the following comprehensive approach:

  • Multi-system validation: Test candidate ligands across different expression systems, including:

    • Heterologous expression in HEK293 cells (though note that even stable transfection may not yield homogeneous receptor expression)

    • Native cells with confirmed endogenous GPR18 expression (verified by RT-PCR)

    • Primary cells from relevant tissues rather than transformed cell lines

  • Investigate biased signaling: The discrepancies in the literature may reflect biased agonism at GPR18, where different ligands preferentially activate distinct signaling pathways. Researchers should:

    • Simultaneously measure multiple effector pathways (Gαi/o, β-arrestin, ERK, calcium) for each tested compound

    • Consider that NAGly may act as a biased ligand at GPR18, explaining contradictory reports

    • Compare signaling profiles of putative ligands including NAGly, AEA (anandamide), AbnCBD, O-1602, and endocannabinoids

  • Control for indirect effects: Some reported GPR18 activators may work through indirect mechanisms:

    • Test whether effects persist in the presence of cannabinoid receptor antagonists

    • Investigate cross-talk with other signaling systems

    • Verify that responses are PTX-sensitive to confirm Gαi/o involvement

The controversy is exemplified by studies showing that NAGly activates GPR18 in some systems (inhibiting cAMP production in a PTX-sensitive manner), while other studies using sympathetic cervical ganglia expressing GPR18 found that NAGly increased calcium mobilization rather than the expected decrease for a Gαi/o-coupled receptor .

What experimental challenges exist in studying recombinant GPR18, and how can they be overcome?

Researchers face several significant challenges when working with recombinant GPR18:

  • Heterogeneous receptor expression: Even with stable expression systems, GPR18 tends to generate heterogeneous cell populations with variable receptor expression levels.

    Solution: Use FACS sorting to select high-expressing cell populations or employ inducible expression systems. Adding a preprolactin signal sequence and multiple epitope tags (e.g., pplss-3HA-hGPR18) can enhance surface expression . Always quantify both surface and total receptor expression ratios.

  • Inconsistent functional responses: Many studies report difficulties reproducing published functional responses to NAGly and other putative GPR18 ligands.

    Solution: Implement parallel readout systems simultaneously measuring multiple signaling pathways (calcium, ERK, β-arrestin, MTORC1). Test responses across a range of ligand concentrations (10 nM to 10 μM), as some effects may be concentration-dependent .

  • Distinguishing direct from indirect effects: GPR18 ligands may have off-target effects at related receptors or transporters.

    Solution: Use specific antagonists for related receptors (CB1, CB2, GPR55) alongside GPR18-specific tools like PSB-CB5 (GPR18 antagonist) . Employ lentiviral shRNA to knock down GPR18 expression to confirm specificity of observed effects .

  • Cell line variability: Cell lines reported to express functional GPR18 may not consistently express the receptor.

    Solution: Always verify GPR18 expression by RT-PCR before conducting experiments. Consider primary cells from relevant tissues as more reliable than immortalized cell lines .

Table 1: Comparison of GPR18 Expression Systems and Their Challenges

Expression SystemAdvantagesChallengesRecommendations
Transient HEK293Simple, rapid implementationVariable expression levels, short experimental windowUse for initial screening only, verify with stable systems
Stable HEK Flp-inConsistent integration siteHeterogeneous expression even after selectionAdd signal sequences, use FACS to isolate high expressers
pplss-3HA-hGPR18 Flp-inEnhanced surface expressionStill variable expression in cell populationQuantify surface:internal receptor ratios
Endogenous expressersNative signaling machinery presentLow expression levels, variable between passagesVerify expression by RT-PCR for each experiment

How does NAGly modulate glycinergic synaptic transmission, and what implications does this have for pain research?

NAGly modulates glycinergic synaptic transmission through several complementary mechanisms that collectively enhance inhibitory control in pain-processing neural circuits:

  • Inhibition of glycine transport: NAGly selectively inhibits the glycine transporter GLYT2, but not GLYT1, in the superficial dorsal horn. This inhibition:

    • Prolongs the decay phase of glycine-mediated inhibitory postsynaptic currents (IPSCs)

    • Produces a strychnine-sensitive inward current similar to that produced by ALX-1393 (GLYT2 inhibitor)

    • Results in increased variance of the inward current, indicating enhanced action of endogenous glycine

  • Direct modulation of glycine receptors: NAGly affects exogenously applied glycine responses by:

    • Prolonging the decay of glycine-induced inward currents

    • Decreasing the amplitude of currents induced by both glycine and β-alanine

    • Exhibiting selectivity for glycine over β-alanine in these modulatory effects

  • Dual modulation of inhibitory and excitatory transmission: NAGly produces a balanced effect by:

    • Enhancing inhibitory glycinergic transmission

    • Simultaneously decreasing excitatory NMDA-mediated synaptic transmission

    • Creating a complementary mechanism for dampening nociceptive signaling

These findings provide a cellular explanation for NAGly's spinal analgesic effects and suggest new therapeutic approaches for pain management. Importantly, these effects appear to be independent of cannabinoid receptor activation, positioning NAGly as a unique analgesic compound working primarily through glycinergic mechanisms in pain processing regions .

The methodological approach for investigating these mechanisms should include:

  • Whole-cell patch clamp recordings from lamina II neurons in spinal cord slices

  • Pharmacological isolation of glycinergic currents using CNQX and bicuculline

  • Measurement of both spontaneous and evoked inhibitory postsynaptic currents

  • Comparative analysis with specific glycine transporter inhibitors (ALX-1393, ALX-5407)

  • Verification of glycine receptor involvement using strychnine blockade

What is the relationship between NAGly, GPR18, and immune system function?

NAGly has emerged as an important immunomodulatory lipid that regulates immune cell function through GPR18-dependent mechanisms:

  • Fasting-induced NAGly production: Recent research has identified NAGly as a caloric state-dependent circulating molecule. A 24-hour fast induces elevated circulating levels of NAGly, suggesting it may serve as a metabolic signal during energy deficit states .

  • Anti-inflammatory effects in T cells: NAGly exerts significant anti-inflammatory effects in CD4+ T cells through:

    • Activation of GPR18 receptor signaling

    • Modulation of MTORC1 signaling pathways

    • Specific inhibition of pro-inflammatory cytokine production

  • Signaling mechanisms: The anti-inflammatory action of NAGly occurs via:

    • Blunted phosphorylation of ribosomal protein S6, indicating reduced MTORC1 activity

    • GPR18-dependent signaling that can be replicated by selective GPR18 agonists like KD107

    • Reduced production of pro-inflammatory cytokines including IFNγ and IL-17

  • Bidirectional immunomodulation: GPR18 signaling appears to have bidirectional effects on different T cell subsets:

    • GPR18 activation reproduces the anti-inflammatory effect of NAGly in Th1 and Th17 cells

    • Conversely, GPR18 antagonism with PSB-CB5 induces IL-4 secretion, potentially promoting Th2 responses

    • This suggests differential regulation of distinct T cell subtypes through the NAGly-GPR18 axis

These findings position the NAGly-GPR18 system as a potential therapeutic target for inflammatory and autoimmune conditions. Researchers investigating this relationship should employ:

  • Specific GPR18 agonists (KD107) and antagonists (PSB-CB5)

  • Measurement of multiple cytokine profiles (IFNγ, IL-17, IL-4)

  • Analysis of MTORC1 signaling components (phosphorylation of S6 and P70S6K)

  • Genetic approaches with lentiviral-transduced shRNA targeting GPR18

What are the best approaches for studying ligand interactions with GPR18?

Studying ligand interactions with GPR18 requires specialized methodologies to address the complexities of this receptor system:

  • Cell-based functional assays: Implement multiple complementary approaches:

    • β-arrestin recruitment assays using DiscoveRx PathHunter technology with enzyme fragment complementation

    • Calcium mobilization assays in stably expressing cell lines

    • ERK1/2 phosphorylation quantification as a measure of MAPK pathway activation

    • Inward current measurements using electrophysiological approaches

  • Recombinant expression systems optimization:

    • Express GPR18 with N-terminal preprolactin signal sequence and HA-tags to enhance surface expression

    • Quantify both surface and total receptor expression to calculate surface:internal ratios

    • Compare expression levels to well-characterized receptors like CB1 as benchmarks

  • Ligand screening considerations:

    • Test a concentration range from nanomolar to micromolar (typically 10 nM to 10 μM)

    • Include structurally-related inactive compounds as negative controls

    • Always verify activity of putative ligands (NAGly, AEA, AbnCBD, O-1602) in each system

    • Use selective antagonists (O-1918, PSB-CB5) to confirm receptor specificity

  • Data interpretation cautions:

    • Consider the possibility of biased agonism when interpreting disparate results across different assay systems

    • Report EC50 values with confidence intervals (e.g., NAGly EC50 of 600 nM for β-arrestin recruitment)

    • Recognize that ligands may exhibit inverted efficacy in different assay systems

Table 2: Comparison of Different Assay Systems for GPR18 Pharmacology

Assay SystemSignaling PathwayAdvantagesLimitationsExample Findings
β-arrestin recruitmentβ-arrestin pathwayQuantitative, good dynamic rangeMay miss G-protein biased ligandsNAGly EC50 ~600 nM
Calcium mobilizationGq or Gβγ-mediatedReal-time kinetics, widely usedConflicting reports in literatureVariable responses to NAGly
ERK phosphorylationMAPK cascadeIntegrates multiple upstream signalsTime-dependent responsesCBD shows antagonist properties
ElectrophysiologyIon channel modulationDirect functional readoutLow throughput, technical challengesNAGly enhances glycinergic currents

How should researchers interpret contradictory data regarding GPR18 signaling and ligand specificity?

The GPR18 field is characterized by conflicting reports regarding receptor pharmacology. Researchers should consider these strategies for reconciling contradictory findings:

  • Recognize the potential for biased agonism: GPR18 appears to signal through multiple pathways, and ligands may preferentially activate different pathways. This phenomenon of biased agonism provides a plausible explanation for apparent discrepancies in GPR18 activation in the literature . Different assay systems may preferentially detect certain signaling modalities while missing others.

  • Account for system-specific factors: Several factors can contribute to contradictory results:

    • Cell type-specific expression of interacting proteins and signaling components

    • Varying receptor expression levels across different studies

    • Methodological differences in assay conditions, timing, and readouts

    • Potential off-target effects at related receptors or transporters

  • Validation through multiple approaches: To build confidence in results:

    • Employ multiple assay systems measuring different signaling outputs

    • Verify findings in both recombinant systems and cells with endogenous receptor expression

    • Use both gain-of-function (agonists) and loss-of-function (antagonists, knockdown) approaches

    • Compare results with established cannabinoid receptor effects as reference points

  • Standardized reporting of experimental conditions: Detailed reporting of:

    • Receptor constructs and expression systems used

    • Surface receptor quantification methods and results

    • Full concentration-response relationships rather than single concentrations

    • Time course of responses for kinetically variable pathways like ERK phosphorylation

A key example of contradictory findings is the report that NAGly activates GPR18 via Gαi/o in some systems (inhibiting cAMP), while in sympathetic cervical ganglia expressing GPR18, NAGly increases rather than decreases calcium mobilization, contradicting the expected response for a Gαi/o-coupled receptor . These contradictions may reflect genuine biological complexity rather than experimental error.

What emerging research areas might elucidate the physiological roles of the NAGly-GPR18 system?

Several promising research directions could significantly advance our understanding of the NAGly-GPR18 system:

  • Metabolic regulation and fasting responses: Recent identification of NAGly as a caloric state-dependent circulating molecule opens exciting avenues for investigation:

    • Determine the cellular source of fasting-induced NAGly production

    • Investigate NAGly's role in coordinating metabolic and immune responses during energy deficit

    • Explore potential interactions with other fasting-induced signaling molecules

  • Immune system modulation: The anti-inflammatory effects of NAGly via GPR18 warrant deeper investigation:

    • Map the effects of NAGly-GPR18 signaling across different immune cell subsets

    • Determine therapeutic potential in models of inflammatory and autoimmune disease

    • Investigate whether immune cells represent both sources and targets of NAGly signaling

  • Pain modulation mechanisms: The dual action of NAGly on inhibitory and excitatory synaptic transmission suggests novel analgesic approaches:

    • Explore the development of selective GLYT2 inhibitors based on NAGly's structure

    • Investigate potential synergistic effects between glycinergic and cannabinoid mechanisms

    • Determine whether chronic pain states alter NAGly production or GPR18 expression

  • Biased signaling exploration: The evidence for biased agonism at GPR18 presents opportunities to:

    • Develop pathway-selective GPR18 modulators

    • Identify the structural determinants of ligand bias

    • Correlate specific signaling pathways with distinct physiological outcomes

  • Development of improved research tools: Address current technical limitations through:

    • Generation of GPR18 knockout mouse models

    • Development of highly selective GPR18 antibodies for immunohistochemistry

    • Creation of stabilized cell lines with reliable GPR18 expression and function

These research directions promise to clarify the physiological significance of the NAGly-GPR18 system and may lead to novel therapeutic approaches for pain, inflammation, and metabolic disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.