Recombinant Mouse NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 (Ndufa1)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

Recombinant Mouse Ndufa1 is a lab-generated version of the Ndufa1 gene product, a 70-amino-acid protein (7.5 kDa) essential for the activity of mitochondrial Complex I (NADH:ubiquinone oxidoreductase) . This protein is an accessory subunit of Complex I, which resides in the inner mitochondrial membrane and facilitates electron transfer from NADH to ubiquinone during oxidative phosphorylation . Unlike catalytic subunits, Ndufa1 stabilizes the enzyme’s structure and anchors it to the membrane .

Production and Purification

Recombinant mouse Ndufa1 is typically expressed in E. coli systems for high yield and purity . Key production details include:

ParameterSpecification
Expression SystemE. coli
TagN-terminal His tag for affinity chromatography
Purity>90% (verified by SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0) at -80°C
ReconstitutionDeionized water or glycerol-containing buffers for long-term stability

Functional Role in Complex I

  • Essential for Enzyme Activity: Complementation studies show that restoring Ndufa1 in mutant cells rescues Complex I activity to 100% of wild-type levels .

  • Mechanism: While not directly involved in electron transfer, Ndufa1 ensures proper assembly of the transmembrane domain, which is required for proton translocation .

  • Pathogenic Mutations: The G32R mutation in human NDUFA1 disrupts Complex I assembly, leading to mitochondrial disorders like Leigh syndrome and cardiomyopathy .

Disease Modeling

Recombinant Ndufa1 is used to study mitochondrial Complex I deficiencies, such as:

  • Leber’s hereditary optic neuropathy

  • Parkinson’s disease

  • Lactic acidosis and hypotonia

Experimental Use Cases

  • BN-PAGE and Immunoblotting: Detects Complex I assembly defects in patient-derived cells .

  • Respiration Assays: Measures oxygen consumption rates in mitochondria after recombinant protein supplementation .

  • Antibody Validation: Commercial antibodies (e.g., Proteintech 15561-1-AP) use recombinant Ndufa1 for specificity testing in WB/IHC .

Key Research Insights

  • Complementation Studies: Hamster NDUFA1 cDNA restored Complex I activity in mutant cell lines (e.g., CCL16-B2), confirming its indispensability .

  • Conservation: The two-domain structure is evolutionarily conserved, underscoring its structural role across species .

  • Therapeutic Potential: Gene therapy targeting NDUFA1 could ameliorate Complex I deficiencies, though clinical trials are pending .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
Ndufa1; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1; Complex I-MWFE; CI-MWFE; NADH-ubiquinone oxidoreductase MWFE subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-70
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MWFEILPGLAIMGVCLVIPGVSTAYIHKFTNGGKEKRVARVQYQWYLMERDRRISGVNRYYVSKGLENID
Uniprot No.

Target Background

Function

Ndufa1 is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), not believed to be directly involved in catalysis. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone as its presumed immediate electron acceptor.

Gene References Into Functions
  1. In an X-linked model of partial Complex I deficiency, Ndufa1 mutant males exhibited reduced respiratory exchange and decreased heat production. PMID: 28506826
  2. Species-specific and mutant MWFE proteins impact the assembly of a functional mammalian mitochondrial Complex I. PMID: 11937507
Database Links
Protein Families
Complex I NDUFA1 subunit family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein; Matrix side.

Q&A

What is the structural and functional significance of NDUFA1 in mitochondrial complex I?

NDUFA1 encodes the MWFE polypeptide, which is a 70-amino acid protein predicted to be a membrane protein with essential functions in complex I activity. Despite being historically categorized as an "accessory protein" (one of approximately 28 such proteins in complex I), research has demonstrated that MWFE is absolutely essential for active complex I in mammals . The protein has a distinct structural organization with a highly hydrophobic N-terminal domain and a hydrophilic, positively charged C-terminal domain, suggesting it is likely associated with the integral membrane fraction of the complex .

The functional significance of NDUFA1 is demonstrated by the fact that a mutation creating a truncated and abnormal MWFE protein results in severely reduced complex I activity (<10% of normal) . This essential role contradicts earlier classifications of NDUFA1 as merely "accessory" based on its absence from the 14-polypeptide core complex found in prokaryotes.

What are the key specifications for working with recombinant mouse NDUFA1 protein?

Recombinant mouse NDUFA1 protein is typically expressed in mammalian expression systems such as HEK293 cells to ensure proper folding and post-translational modifications . The protein can be tagged with various combinations such as His-Fc-Avi tags to facilitate purification and detection . Key specifications include:

ParameterSpecification
Expression systemHEK293 cells
Purification tagsHis, Fc, Avi (combinations available)
Purity≥85% by SDS-PAGE
Endotoxin level< 1.0 EU per μg (determined by LAL method)
Storage bufferPBS buffer
Storage conditions-20°C to -80°C (avoid repeated freeze-thaw)
Stability≥6 months under proper storage conditions

These specifications ensure the recombinant protein maintains structural integrity and functional activity for research applications .

How does the NDUFA1 gene differ across species, and what implications does this have for research?

The NDUFA1 gene shows a high degree of conservation across mammalian species, indicating its fundamental importance in complex I function. The mouse, bovine, and human cDNA sequences available in databases demonstrate significant sequence homology . This conservation is functionally relevant, as demonstrated by the ability of hamster NDUFA1 cDNA to complement mutations in Chinese hamster cell lines, restoring rotenone-sensitive complex I activity to approximately 100% of parent cell activity .

The NDUFA1 gene's X-chromosome location is conserved across mammals, with linkage conservation suggesting evolutionary importance . This cross-species conservation makes mouse NDUFA1 a valuable model for studying the role of this protein in complex I function, with potential translational implications for human mitochondrial diseases.

How can NDUFA1 complementation studies be designed to investigate complex I deficiencies?

Complementation studies using NDUFA1 require careful experimental design. Based on established methodologies, researchers should:

  • Begin with a well-characterized cell line harboring NDUFA1 deficiency (e.g., the CCL16-B2 mutant line with severely reduced complex I activity)

  • Clone wild-type NDUFA1 cDNA into an appropriate expression vector (pBK-CMV has been successfully used)

  • Perform sequence verification before transfection

  • Transfect mutant cells using standard methods and select transfectants

  • Allow sufficient time for protein expression and complex I assembly (complementation is not instantaneous)

  • Establish selection conditions to identify successful complementation:

    • Direct selection in galactose medium (DMEM/Gal), where only respiratory-competent cells survive

    • Alternatively, select for vector marker (e.g., neomycin resistance) before testing respiratory function

This approach allows for quantitative assessment of complementation efficiency by measuring complex I activity restoration, providing insights into both NDUFA1 function and complex I assembly mechanisms .

What insights can NDUFA1 mutants provide about complex I assembly and function?

NDUFA1 mutants serve as powerful tools for investigating complex I biology. The CCL16-B2 mutant, which has a frameshift mutation resulting in a truncated and abnormal MWFE protein, demonstrates that:

  • NDUFA1 is essential for complex I function despite being classified as an "accessory" protein

  • Complex I activity is severely compromised (<10% of normal) when MWFE is defective

  • The respiratory chain from ubiquinone to oxygen remains largely intact in NDUFA1 mutants, as evidenced by near-normal succinate- and α-glycerolphosphate-stimulated respiration

These mutants allow researchers to:

  • Study the step-by-step assembly process of complex I

  • Investigate the specific roles of accessory proteins

  • Introduce specific mutations to probe structure-function relationships

  • Test compensatory mechanisms for complex I deficiency, such as the ability of yeast NADH dehydrogenase (Ndi1p) to restore respiration in NDUFA1-deficient cells

What methodologies are most effective for studying NDUFA1's role in respiratory chain activities?

Several methodological approaches can be employed to study NDUFA1's role in respiratory chain activities:

  • Oxygen consumption measurements: Monitor rotenone-sensitive respiration stimulated by malate plus glutamate using oxygen electrodes or Seahorse analyzers. This approach has demonstrated that NDUFA1-deficient cells have <10% normal complex I-dependent respiration, while complemented cells show restoration to wild-type levels .

  • Genetic complementation: Transfect mutant cells with wild-type or modified NDUFA1 cDNA to assess functional rescue. This approach enables structure-function analysis by introducing specific mutations.

  • Metabolic selection: Culture cells in galactose medium (DMEM/Gal) instead of glucose to force reliance on oxidative phosphorylation, providing a selective pressure for functional complex I .

  • Complex I activity assays: Measure NADH-ubiquinone oxidoreductase activity directly, though indirect methods based on substrate-stimulated respiration provide reliable functional assessment .

  • Alternative NADH dehydrogenase expression: Introduce yeast NDI1 gene to bypass complex I and assess downstream respiratory chain integrity .

What are the optimal storage and handling conditions for recombinant NDUFA1 protein?

Proper storage and handling of recombinant NDUFA1 protein is critical to maintain its structural integrity and biological activity:

  • Storage temperature: Store at -20°C to -80°C for long-term stability

  • Buffer conditions: PBS buffer provides appropriate ionic strength and pH

  • Aliquoting: Divide protein into single-use aliquots to avoid repeated freeze-thaw cycles

  • Stability: When properly stored, recombinant NDUFA1 maintains stability for at least 6 months

  • Thawing procedure: Thaw aliquots rapidly at room temperature and keep on ice once thawed

  • Working concentration: Dilute to working concentration immediately before use

  • Quality control: Verify protein integrity by SDS-PAGE before critical experiments

Researchers should validate each new lot of recombinant protein by assessing purity (≥85% by SDS-PAGE) and endotoxin levels (<1.0 EU per μg) if using in cell-based assays .

What cell culture systems are appropriate for studying NDUFA1 function?

Several cell culture systems have been validated for NDUFA1 research:

  • Chinese hamster cell lines: The parental Chinese hamster cell lines and respiration-deficient (res-) mutants derived from them have been extensively characterized . These include:

    • CCL16-B2: NDUFA1 mutant with severely reduced complex I activity

    • V79-G4: Another respiration-deficient complementation group

  • Culture media considerations:

    • Standard growth medium: DMEM with 5 mg/ml glucose, 10% FCS, nonessential amino acids, gentamycin, and fungizone

    • Selective medium: DMEM/Gal (glucose replaced by 1 mg/ml galactose) to distinguish respiration-competent (res+) from respiration-deficient (res-) cells

  • Transfection systems:

    • Expression vectors such as pBK-CMV have been successfully used for NDUFA1 complementation studies

    • Selection can be performed using neomycin resistance or direct metabolic selection in DMEM/Gal

When designing experiments, researchers should account for the time required for gene expression, protein incorporation into complex I, and generation of functional mitochondria following transfection .

How should researchers measure complex I activity in experiments involving NDUFA1?

Complex I activity measurements in NDUFA1 research require careful consideration of methodology:

  • Indirect measurement via respiration:

    • Use malate plus glutamate as substrates to generate NADH in the mitochondrial matrix

    • Measure oxygen consumption using polarographic methods

    • Include rotenone as a specific complex I inhibitor to determine rotenone-sensitive respiration

    • Background measurements should include wild-type cells inhibited with rotenone

  • Direct complex I activity measurement:

    • Measure NADH-ubiquinone oxidoreductase activity in isolated mitochondria or submitochondrial particles

    • Monitor NADH oxidation spectrophotometrically at 340 nm

    • Use artificial electron acceptors like decylubiquinone

  • Data interpretation:

    • Compare rotenone-sensitive respiration rates between wild-type, mutant, and complemented cells

    • Account for possible effects on mitochondrial protein import in respiration-deficient cells

    • Validate complex I specificity by examining other respiratory chain complexes (e.g., succinate- and α-glycerolphosphate-stimulated respiration)

  • Growth-based functional assays:

    • Assess cell growth in glucose-limited or galactose-containing medium as a functional readout of respiratory capacity

    • Monitor colony formation and growth rates in selective medium

How can researchers distinguish between NDUFA1-specific effects and general mitochondrial dysfunction?

Distinguishing NDUFA1-specific effects from general mitochondrial dysfunction requires comprehensive control experiments:

  • Assess multiple respiratory chain complexes:

    • Measure succinate oxidation (complex II → complex IV)

    • Measure α-glycerolphosphate oxidation (mitochondrial glycerol-3-phosphate dehydrogenase → complex IV)

    • Compare patterns of deficiency across respiratory chain activities

  • Complementation specificity:

    • Verify that NDUFA1 cDNA complements the specific mutant (e.g., CCL16-B2) but not mutants in other complementation groups (e.g., V79-G4)

    • Ensure that phenotypic rescue correlates with restoration of complex I activity

  • Alternative NADH dehydrogenase expression:

    • Introduction of yeast NDI1 gene, which encodes a single-subunit NADH dehydrogenase, can bypass mammalian complex I

    • If NDI1 restores respiration, this confirms intact downstream respiratory components and localizes the defect to complex I

  • Mitochondrial membrane potential (ΔΨ) analysis:

    • Reduced ΔΨ can affect protein import into mitochondria, causing secondary defects

    • Distinguish primary (complex I) from secondary (protein import) defects in experimental design

What are the considerations for interpreting respiratory chain activity measurements in NDUFA1 studies?

Proper interpretation of respiratory chain activity measurements requires:

  • Normalization approaches:

    • Express activities relative to mitochondrial mass markers (e.g., citrate synthase)

    • Compare to appropriate controls (parental cell lines, isogenic controls)

    • Account for possible variations in mitochondrial content between wild-type and mutant cells

  • Statistical analysis:

    • Perform multiple independent measurements (n≥3)

    • Apply appropriate statistical tests to determine significance

    • Report both absolute values and percentages of control activity

  • Integration of multiple assays:

    • Compare results from different methodological approaches (e.g., oxygen consumption vs. direct complex I activity)

    • Correlate biochemical measurements with functional outcomes (growth in selective media)

    • Assess protein expression levels in parallel with activity measurements

  • Threshold effects:

    • Consider that complex I typically has excess capacity, and significant activity reduction (>70-80%) may be required before cellular consequences become apparent

    • Partial activity restoration may be sufficient for cellular function

How should researchers validate the specificity of NDUFA1 complementation in mutant cell lines?

Validating NDUFA1 complementation specificity requires several approaches:

  • Genetic controls:

    • Test NDUFA1 cDNA complementation in multiple cell lines (e.g., CCL16-B2 and V79-G4)

    • Verify complementation occurs only in the appropriate mutant (CCL16-B2) but not in other respiration-deficient lines (V79-G4)

    • Use empty vector controls to rule out non-specific effects

  • Functional validation:

    • Confirm restoration of rotenone-sensitive respiration to wild-type levels

    • Verify growth capability in selective medium (DMEM/Gal)

    • Demonstrate stable transfection and long-term maintenance of respiratory function

  • Molecular verification:

    • Confirm NDUFA1 gene expression by Northern analysis

    • Verify protein expression and incorporation into complex I

    • Sequence verification of the transfected gene to rule out secondary mutations

  • Cross-species complementation controls:

    • Test complementation with NDUFA1 from different species to confirm functional conservation

    • Use this approach to investigate species-specific differences in NDUFA1 function

These validation steps ensure that observed phenotypic changes can be specifically attributed to NDUFA1 function rather than experimental artifacts or secondary effects.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.