Recombinant Mouse NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 (Ndufb3)

Shipped with Ice Packs
In Stock

Description

Definition and Overview of Recombinant Mouse NADH Dehydrogenase [Ubiquinone] 1 Beta Subcomplex Subunit 3 (Ndufb3)

Recombinant Mouse NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 (Ndufb3) is a bioengineered variant of the endogenous Ndufb3 protein, expressed in Escherichia coli with an N-terminal His tag for purification . Native Ndufb3 is a 98-amino acid accessory subunit of mitochondrial Complex I, the largest enzyme in the electron transport chain (ETC), responsible for transferring electrons from NADH to ubiquinone . The recombinant version retains the native protein’s structural and functional properties while enabling scalable production for research and therapeutic applications .

Role in Mitochondrial Complex I Function

Ndufb3 is essential for Complex I assembly and stability but does not directly participate in catalysis . Key functions include:

  • Structural scaffolding: Maintains the membrane arm of Complex I, ensuring proper electron transfer from NADH to ubiquinone .

  • Redox regulation: Modulates mitochondrial ROS (reactive oxygen species) levels by influencing Complex I activity .

Interactions: Ndufb3 binds to core subunits like NDUFB4, NDUFB7, and NDUFA9 to form the hydrophobic subcomplex .

Disease Models and Mutations

Mutations in NDUFB3 cause mitochondrial complex I deficiency, a disorder characterized by impaired ATP production and oxidative phosphorylation . Key findings:

  • p.Trp22Arg variant: Recurrent mutation linked to short stature, facial dysmorphism, and mild biochemical defects .

  • Residual activity: Patients with NDUFB3 mutations retain 17–40% Complex I activity due to partial assembly of subcomplexes .

StudyKey ObservationOutcomeSource
Exome sequencingIdentification of pathogenic NDUFB3 mutationsRestored Complex I activity via wild-type cDNA complementation
BN-PAGE analysisReduced assembled Complex I in patient musclePartially assembled intermediates (~650 kDa)

Cancer Biology

Ndufb3 expression inversely correlates with hepatocellular carcinoma (HCC) progression:

  • Knockdown: Enhances HCC cell proliferation, migration, and invasion by reducing Complex I activity and ROS levels .

  • Overexpression: Suppresses tumor growth by increasing mitochondrial ROS, inducing apoptosis via Bcl-2 downregulation .

Detection and Analytical Methods

Antibodies and Techniques:

  • Anti-NDUFB3 [EPR15571] (Abcam): A rabbit monoclonal antibody validated for Western blot, immunoprecipitation, and immunohistochemistry. Detects an 11 kDa band in human/mouse samples .

  • Blue-native PAGE: Quantifies Complex I assembly status in patient samples .

Clinical and Therapeutic Implications

Diagnostic Utility:

  • Mitochondrial disorders: NDUFB3 mutations are screened in cases of suspected complex I deficiency .

  • Cancer biomarker: Low Ndufb3 expression in HCC may indicate aggressive disease .

Therapeutic Potential:

  • Gene therapy: Wild-type NDUFB3 cDNA restores Complex I function in deficient cells .

  • ROS modulation: Targeting Ndufb3 to balance mitochondrial redox states in cancer and neurodegenerative diseases .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Specify your desired tag type during ordering for prioritized development.
Synonyms
Ndufb3; NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3; Complex I-B12; CI-B12; NADH-ubiquinone oxidoreductase B12 subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-104
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
AAGHGHEHGHEHGHGHGKMELPDYRQWKIEGTPLETVQKKLAARGLRDPWARNEAWRYMG GFAGNITFPSVILKGFKWGFAAFVVALGAEYFLDSQNGDKKHH
Uniprot No.

Target Background

Function
Recombinant Mouse NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 (Ndufb3) is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is not believed to be directly involved in catalysis. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone thought to be the immediate electron acceptor.
Database Links

KEGG: mmu:66495

STRING: 10090.ENSMUSP00000027193

UniGene: Mm.2033

Protein Families
Complex I NDUFB3 subunit family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein; Matrix side.

Q&A

What is the molecular structure and function of mouse Ndufb3?

Mouse Ndufb3 is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), which is the first enzyme in the electron transport chain of mitochondria. The protein localizes to the inner membrane of the mitochondrion as a single-pass membrane protein . While it is believed not to be directly involved in catalysis, Ndufb3 plays a crucial role in the structural integrity and assembly of Complex I. This complex functions in the transfer of electrons from NADH to ubiquinone in the respiratory chain .

The mouse Ndufb3 shares high homology with human NDUFB3, and both are essential for proper mitochondrial function. As an accessory subunit, it contributes to the stability of the complex rather than directly participating in electron transfer reactions. Research indicates that Ndufb3 is part of a network of proteins that coordinate in maintaining mitochondrial membrane potential and energy production through oxidative phosphorylation.

What techniques are available for detecting and measuring Ndufb3 expression in mouse tissue samples?

When studying Ndufb3 expression in mouse tissue samples, researchers commonly employ multiple complementary techniques:

  • RT-qPCR: This technique allows quantitative measurement of Ndufb3 mRNA expression, as demonstrated in studies examining respiratory chain components . Primers specific to mouse Ndufb3 can detect transcript levels with high sensitivity.

  • Western Blotting: For protein-level detection, western blotting using antibodies specific to mouse Ndufb3 provides quantitative assessment of expression levels. This is particularly valuable when comparing expression across different tissue types or experimental conditions.

  • Immunohistochemistry/Immunofluorescence: These techniques allow visualization of Ndufb3 localization within tissue sections, providing spatial information about expression patterns.

  • Flow Cytometry: For studies focusing on mitochondrial function in relation to Ndufb3 expression, flow cytometry combined with mitochondrial markers (like MitoSOX for mitochondrial ROS or MitoTracker for mitochondrial mass) can be employed .

It's important to note that the correlation between mRNA and protein expression for mitochondrial genes like Ndufb3 can be moderate, with studies showing approximately 25-37% correlation between transcript and protein levels . Therefore, measuring both transcript and protein levels is recommended for comprehensive expression analysis.

How does Ndufb3 contribute to mitochondrial function in normal mouse cells?

Ndufb3 plays several important roles in normal mitochondrial function:

  • Complex I assembly and stability: As an accessory subunit of Complex I, Ndufb3 contributes to the proper assembly and structural integrity of this large multiprotein complex .

  • Regulation of mitochondrial reactive oxygen species (mitoROS): Research has demonstrated that Ndufb3 expression levels directly impact mitoROS production. Specifically, NDUFB3 knockdown significantly reduces mitoROS levels in certain cell types .

  • Maintenance of mitochondrial membrane potential (Δψm): Proper expression of Ndufb3 supports the maintenance of mitochondrial membrane potential, which is crucial for ATP production through oxidative phosphorylation .

  • Support of respiratory chain function: As part of Complex I, Ndufb3 indirectly supports electron transfer from NADH to ubiquinone, a critical step in cellular energy production .

  • Mitochondrial morphology maintenance: Research indicates that normal expression levels of respiratory chain components like Ndufb3 are associated with proper mitochondrial network structure and morphology .

Disruption of Ndufb3 expression can lead to mitochondrial dysfunction characterized by altered respiratory capacity, reduced ATP production, and changes in mitochondrial morphology and dynamics.

What phenotypes are observed in mouse models with Ndufb3 deficiency?

Mouse models with Ndufb3 deficiency exhibit several characteristic phenotypes related to mitochondrial dysfunction:

  • Reduced mitochondrial respiratory function: Ndufb3 deficiency leads to decreased expression of respiratory chain components and reduced oxygen consumption rates .

  • Decreased ATP production: With compromised Complex I function, ATP synthesis through oxidative phosphorylation is significantly reduced .

  • Altered mitochondrial morphology: Electron microscopy studies reveal that mitochondria in Ndufb3-deficient cells display altered ultrastructure, including swelling, fragmentation, and disrupted cristae organization .

  • Reduced mitoROS levels: NDUFB3 knockdown significantly reduces mitochondrial reactive oxygen species levels, indicating altered electron transport chain function .

  • Metabolic reprogramming: Cells may shift toward increased glycolysis to compensate for reduced oxidative phosphorylation capacity .

These phenotypes highlight the essential role of Ndufb3 in maintaining proper mitochondrial function and energy metabolism in mouse models.

What are the optimal experimental conditions for measuring Ndufb3-dependent Complex I activity?

Measuring Ndufb3-dependent Complex I activity requires careful experimental design and consideration of multiple factors:

Recommended Protocol:

  • Sample preparation:

    • Isolate mitochondria using differential centrifugation in a sucrose-based buffer

    • Maintain samples at 4°C throughout preparation to preserve enzymatic activity

    • Consider using digitonin or n-dodecyl-β-D-maltoside for membrane permeabilization

  • Activity measurement conditions:

    • Buffer composition: 25 mM KH₂PO₄ (pH 7.4), 5 mM MgCl₂, 0.25% BSA

    • Substrate concentration: 5 mM NADH

    • Electron acceptor: 65 μM ubiquinone-1

    • Temperature: 30°C for optimal enzyme activity

    • Consider adding rotenone (1 μM) in parallel reactions to distinguish specific Complex I activity

  • Detection methods:

    • Spectrophotometric monitoring of NADH oxidation at 340 nm

    • Oxygen consumption measurement using high-resolution respirometry

    • In-gel activity assays following blue native PAGE separation

  • Normalization:

    • Express activity relative to citrate synthase activity or total mitochondrial protein

    • Consider parallel measurement of other respiratory complexes for comparative analysis

How can researchers effectively design Ndufb3 knockdown and overexpression systems?

Designing effective Ndufb3 knockdown and overexpression systems requires careful consideration of several technical aspects:

For Ndufb3 Knockdown:

  • siRNA approach:

    • Design 3-4 siRNA sequences targeting different regions of Ndufb3 mRNA

    • Validate knockdown efficiency by RT-qPCR and western blotting

    • Optimal transfection concentration: 20-50 nM depending on cell type

    • Consider transient vs. stable knockdown based on experimental timeline

  • shRNA approach for stable knockdown:

    • Use lentiviral or retroviral vectors for stable integration

    • Include selection marker (puromycin or hygromycin) for pure population

    • Validate clones for knockdown efficiency and mitochondrial function

  • CRISPR-Cas9 approach:

    • Design gRNAs targeting exons with minimal off-target effects

    • Consider conditional knockout strategies to avoid lethality

    • Validate edited clones by sequencing and expression analysis

For Ndufb3 Overexpression:

  • Vector selection:

    • Use mammalian expression vectors with strong promoters (CMV, EF1α)

    • Consider inducible expression systems (Tet-On/Off) for controlled expression

    • Include appropriate epitope tags (FLAG, HA, His) for detection without interfering with function

  • Expression optimization:

    • Codon-optimize the sequence for mouse expression systems

    • Include proper Kozak sequence for efficient translation

    • Consider subcellular targeting sequences to ensure proper mitochondrial localization

  • Validation methods:

    • Confirm overexpression by western blotting and qPCR

    • Verify mitochondrial localization using immunofluorescence or subcellular fractionation

    • Assess mitochondrial function using assays for complex I activity, oxygen consumption rate, ATP production, and mitoROS levels

Table 1: Comparison of Ndufb3 Manipulation Methods

MethodAdvantagesLimitationsTimelineBest Applications
siRNAEasy delivery, low cost, rapid resultsTransient effect, variable efficiency24-72 hoursAcute effects, initial screening
shRNAStable knockdown, consistent resultsTime-consuming, potential off-target effects2-4 weeksLong-term studies, in vivo models
CRISPR-Cas9Complete knockout possible, high specificityComplex design, potential lethality4-8 weeksGenetic studies, rescue experiments
Plasmid overexpressionHigh expression levels, epitope taggingPotential artifacts from overexpression24-48 hoursProtein interaction studies, localization
Lentiviral overexpressionStable expression, works in various cell typesProduction complexity, biosafety concerns2-3 weeksLong-term studies, difficult-to-transfect cells

Research has demonstrated that NDUFB3 knockdown significantly reduces mitoROS levels in certain cell lines, while overexpression increases mitochondrial functions including oxygen consumption rate, ATP levels, and complex I activity .

What methodological considerations are important when comparing RNA and protein expression levels of Ndufb3?

When comparing RNA and protein expression levels of Ndufb3, researchers should consider several methodological factors that can affect interpretation:

  • Correlation limitations:

    • Studies have shown that only approximately 25-37% of transcript-peptide pairs show correlation for mitochondrial proteins

    • This correlation is much better than the ~5% expected by chance but still indicates significant post-transcriptional regulation

    • For any particular gene like Ndufb3, the probability of transcript level not reflecting protein level is quite high

  • Sample preparation considerations:

    • RNA and protein should be extracted from the same biological samples whenever possible

    • Use standardized protocols to minimize technical variation

    • Include appropriate housekeeping genes/proteins for normalization

  • Quantification methods:

    • For RNA: RT-qPCR provides higher sensitivity and specificity than RNA-seq for targeted analysis

    • For protein: Consider both western blotting and mass spectrometry-based quantification

    • Include standard curves for absolute quantification when possible

  • Environmental factors influencing correlation:

    • External perturbations (like diet in animal models) can affect transcript-protein correlation

    • Interventions dramatically affecting transcript levels are more likely to manifest at the protein level

    • Consider measuring both transcript and protein across multiple time points to capture dynamics

  • Data analysis approach:

    • Use appropriate statistical methods accounting for different dynamic ranges of techniques

    • Consider log transformation of data to normalize distributions

    • Apply correlation statistics (Pearson or Spearman) based on data distribution

Research has shown that while transcripts and proteins are moderately covarying estimations of gene activity, these trends are too weak to support using any one particular transcript as a reliable proxy for the protein without prior validation . This has significant implications for interpreting Ndufb3 expression data, especially in the context of mitochondrial dysfunction studies.

How does recombinant mouse Ndufb3 affect mitochondrial reactive oxygen species (mitoROS) production?

The relationship between Ndufb3 and mitochondrial reactive oxygen species (mitoROS) production is complex and highly relevant to understanding mitochondrial function in both normal and pathological states:

  • Expression-level effects:

    • NDUFB3 knockdown significantly reduces mitoROS levels in multiple cell types, including BCPAP and C643 cells

    • Conversely, NDUFB3 overexpression increases mitoROS levels both in vitro and in ex vivo xenograft models

    • These findings suggest Ndufb3 is a positive regulator of mitoROS production

  • Mechanism of action:

    • As a Complex I accessory subunit, Ndufb3 likely influences electron leakage at this complex

    • Complex I is a major site of superoxide production in the mitochondrial respiratory chain

    • Recombinant Ndufb3 may alter the conformational state or electron transfer efficiency of Complex I

  • Measurement methodology:

    • MitoSOX staining followed by flow cytometry provides quantitative assessment of mitoROS levels

    • For in vivo or ex vivo studies, xenograft tumors can be digested into single-cell suspensions for mitoROS-FACS analysis

    • Controls should include known mitoROS modulators (e.g., antimycin A as a positive control)

  • Experimental considerations:

    • Cell confluence (40-50%) and incubation time (48h) influence detection sensitivity

    • Culture conditions must be standardized across experimental groups

    • Concurrent measurement of mitochondrial mass using MitoTracker helps normalize mitoROS data

Table 2: Effects of Ndufb3 Manipulation on Mitochondrial Parameters

ParameterNdufb3 Knockdown EffectNdufb3 Overexpression EffectMeasurement Method
mitoROS levelsSignificant decreaseSignificant increaseMitoSOX staining + FACS
Complex I activityDecreaseIncreaseSpectrophotometric assay
Oxygen consumption rateDecreaseIncreaseSeahorse analyzer
ATP productionDecreaseIncreaseLuminescence-based assay
Mitochondrial membrane potentialDecreaseIncreaseJC-1 probe fluorescence
Mitochondrial morphologyFragmentationEnhanced networkingConfocal microscopy

These findings highlight the importance of Ndufb3 in regulating mitoROS production, which has implications for understanding its role in normal physiology and disease states, particularly in cancer where altered mitoROS levels can affect tumor growth and survival .

How does Ndufb3 contribute to mitochondrial-derived vesicle (MDV) formation and function?

Ndufb3's role in mitochondrial-derived vesicle (MDV) formation represents an emerging area of research that connects mitochondrial respiratory function with cellular communication and stress response:

  • Expression correlation with MDV markers:

    • Studies have shown that the expression levels of NDUFB3 and other respiratory chain components are altered in conditions with increased MDV production

    • In diabetic foot ulcer (DFU) models, changes in NDUFB3 expression accompany alterations in MDV secretion

  • Functional relationship with MDV pathways:

    • NDUFB3 expression levels affect mitochondrial membrane potential (Δψm), which influences MDV formation

    • Reduced NDUFB3 expression is associated with mitochondrial morphology changes (fragmentation and cristae disruption) that may facilitate MDV budding

    • Expression of NDUFB3 and other respiratory chain genes (MTCO3) is significantly downregulated following exposure to high-glucose-induced MDVs

  • Experimental approaches to study Ndufb3-MDV relationship:

    • Differential centrifugation combined with immunoprecipitation can isolate MDVs for analysis

    • Nanoparticle tracking analysis (NTA) can quantify MDV concentration and size distribution

    • Protein content analysis using BCA method can assess MDV composition in relation to Ndufb3 expression

    • JC-1 probe can measure mitochondrial membrane potential changes that precede MDV formation

  • Methodological considerations:

    • MDV isolation protocols must minimize cellular damage to prevent artificial release of mitochondrial fragments

    • Gentle enzymatic digestion methods better preserve cell membrane and organelle integrity

    • Technical limitations in MDV characterization can be addressed using advanced techniques like tunable resistive pulse sensing or size-sorting flow cytometry

The study of Ndufb3's contribution to MDV biology connects mitochondrial respiratory function with intercellular communication pathways. Researchers investigating this relationship should consider both the direct effects of Ndufb3 on respiratory chain function and the secondary effects on mitochondrial dynamics, stress responses, and vesicle formation mechanisms.

How can recombinant mouse Ndufb3 be utilized to study mitochondrial disorders?

Recombinant mouse Ndufb3 provides a valuable tool for investigating mitochondrial disorders, particularly those involving Complex I dysfunction:

  • Rescue experiments in disease models:

    • Introducing recombinant Ndufb3 into cells with NDUFB3 mutations or deficiencies can assess functional recovery

    • Quantifying restoration of Complex I assembly, activity, and mitochondrial function parameters

    • Determining minimum expression levels required for functional rescue

  • Structure-function relationship studies:

    • Using recombinant Ndufb3 with specific mutations to investigate critical functional domains

    • Comparing wild-type and mutant Ndufb3 effects on Complex I assembly and activity

    • Identifying protein-protein interactions within Complex I using tagged recombinant proteins

  • Therapeutic development applications:

    • Screening compounds that stabilize mutant Ndufb3 or enhance its incorporation into Complex I

    • Developing mitochondrial-targeted delivery systems for recombinant Ndufb3

    • Testing gene therapy approaches using Ndufb3 expression constructs

  • Experimental disease models:

    • Creating cellular models of Complex I deficiency through Ndufb3 manipulation

    • Generating mitochondrial stress conditions to study adaptive responses

    • Modeling specific mitochondrial disorders associated with NDUFB3 mutations

Methodological approach for recombinant Ndufb3 studies in disease models:

a) Production of recombinant protein:

  • Express in E. coli or baculovirus systems with appropriate tags for purification

  • Consider mammalian expression systems for proper post-translational modifications

  • Validate protein folding and activity through biochemical assays

b) Delivery methods:

  • Direct protein delivery using cell-penetrating peptides or liposomal carriers

  • Gene-based approaches using viral vectors or non-viral transfection

  • Ex vivo modification of cells followed by transplantation in animal models

c) Functional assessment:

  • Measure mitochondrial function parameters: oxygen consumption rate, ATP production, membrane potential

  • Assess complex I assembly and activity

  • Quantify mitoROS levels using MitoSOX and flow cytometry

  • Evaluate mitochondrial ultrastructure using transmission electron microscopy

Diseases associated with NDUFB3 include Mitochondrial Complex I Deficiency, Nuclear Type 25 and Isolated Complex I Deficiency , making recombinant Ndufb3 particularly valuable for studying these conditions in mouse models.

What is the role of Ndufb3 in cancer progression, and how can it be targeted therapeutically?

Research into Ndufb3's role in cancer has revealed significant insights with therapeutic implications:

  • Expression patterns and prognostic value:

    • NDUFB3 expression levels predict clinical outcomes in certain cancers, particularly thyroid cancer

    • Higher NDUFB3 expression is associated with favorable progression-free survival

    • NDUFB3 acts as a regulator of mitochondrial reactive oxygen species (mitoROS)

  • Functional impact on cancer cells:

    • NDUFB3 overexpression significantly increases mitochondrial functions in cancer cell lines:

      • Enhances oxygen consumption rate

      • Elevates ATP production

      • Increases Complex I activity

      • Raises mitoROS levels

    • These changes correlate with suppressed tumor growth in xenograft models

  • Therapeutic targeting strategies:

    • Direct modulation of Ndufb3 expression:

      • Gene therapy approaches to increase expression in tumors with low levels

      • RNA interference-based approaches in contexts where Ndufb3 promotes tumor growth

    • Combination approaches:

      • Pairing Ndufb3 overexpression with compounds that exploit elevated mitoROS (e.g., sideroxylin)

      • Combining with metabolic inhibitors to enhance energy stress in cancer cells

    • Targeted drug development:

      • Screening for compounds that modulate Ndufb3 activity or stability

      • Development of mitochondria-targeted drugs that interact with Complex I

  • Experimental evidence supporting therapeutic potential:

    • In mouse xenograft models, NDUFB3 overexpression significantly suppressed tumor growth and prolonged survival

    • Combined treatment with NDUFB3 overexpression and sideroxylin showed enhanced anti-tumor effects

    • NDUFB3 knockdown had the opposite effect, promoting tumor growth

Table 3: Effects of Ndufb3 Modulation in Cancer Models

Cancer ModelInterventionEffect on Tumor GrowthEffect on SurvivalMechanism
Thyroid cancer xenograftsNDUFB3 overexpressionSignificant suppressionProlongedIncreased mitoROS, enhanced oxidative stress
Thyroid cancer xenograftsNDUFB3 knockdownEnhanced growthReducedDecreased mitoROS, reduced oxidative stress
Thyroid cancer xenograftsNDUFB3 overexpression + sideroxylinPotent suppressionSignificantly prolongedSynergistic increase in mitoROS levels

These findings suggest that targeting Ndufb3 and related mitoROS pathways could represent a promising therapeutic strategy for certain cancers, particularly those where NDUFB3 expression correlates with favorable prognosis .

What are the differences in Ndufb3 function between mouse models and human clinical samples?

Understanding the similarities and differences between mouse Ndufb3 and human NDUFB3 is crucial for translational research:

  • Structural and sequence homology:

    • Mouse Ndufb3 and human NDUFB3 share high sequence homology (~85-90%)

    • Both proteins function as accessory subunits of mitochondrial Complex I

    • Conserved functional domains suggest similar roles in complex assembly and stability

  • Expression pattern differences:

    • Tissue-specific expression patterns show subtle differences between species

    • Developmental regulation may vary, affecting interpretation of knockout models

    • Response to environmental stressors and physiological conditions may differ between species

  • Disease manifestations:

    • Mutations in human NDUFB3 are associated with Mitochondrial Complex I Deficiency, Nuclear Type 25

    • Mouse models may not fully recapitulate the clinical features of human NDUFB3-related disorders

    • Species-specific compensatory mechanisms may affect phenotype severity

  • Methodological considerations for cross-species comparisons:

    • Use of species-specific antibodies and primers is essential for accurate detection

    • Protein interaction networks may differ, affecting interpretation of complex assembly studies

    • Consider species-specific post-translational modifications when analyzing function

  • Translational research implications:

    • Validation in human samples/cells is critical before extrapolating findings from mouse models

    • Consider using humanized mouse models for studying human NDUFB3 mutations

    • Patient-derived cells or tissues provide the most relevant context for human disease studies

Table 4: Comparative Analysis of Ndufb3 in Mouse Models and Human Samples

ParameterMouse Ndufb3Human NDUFB3Implications for Research
Protein lengthComparableComparableSimilar structural studies applicable
Complex I integrationConservedConservedMouse models relevant for assembly studies
Tissue expressionSome differencesSome differencesConsider tissue-specific effects in translational studies
mitoROS regulationDemonstratedDemonstratedSimilar role in oxidative stress across species
Disease mutationsExperimental modelsClinical casesHuman mutations may need to be introduced to mouse models
Response to therapeuticsMay differMay differValidate therapeutic approaches in human cells

Understanding these differences is particularly important when using recombinant mouse Ndufb3 to study human mitochondrial disorders or when developing therapeutic approaches targeting this protein.

What are the key quality control parameters for recombinant mouse Ndufb3 production and purification?

Producing high-quality recombinant mouse Ndufb3 requires rigorous quality control procedures:

  • Expression system selection:

    • E. coli: Cost-effective but lacks post-translational modifications

    • Insect cells: Better folding of mitochondrial proteins

    • Mammalian cells: Most physiologically relevant modifications

  • Critical quality attributes to verify:

    • Purity: >95% by SDS-PAGE and size exclusion chromatography

    • Identity: Confirmation by mass spectrometry and western blotting

    • Structural integrity: Circular dichroism to assess secondary structure

    • Aggregation state: Dynamic light scattering to detect aggregates

    • Endotoxin levels: <0.1 EU/μg protein for cell culture applications

  • Functional validation methods:

    • Complex I integration: Ability to incorporate into isolated mitochondrial membranes

    • Impact on mitoROS: Functional effect on mitochondrial ROS production in reconstitution experiments

    • Protein-protein interactions: Co-immunoprecipitation with known interaction partners

  • Storage and stability considerations:

    • Buffer optimization: Typically 25-50 mM phosphate buffer, pH 7.4 with 10% glycerol

    • Temperature sensitivity: Stability at -80°C, -20°C, 4°C, and room temperature

    • Freeze-thaw stability: Maximum allowable freeze-thaw cycles before activity loss

    • Long-term storage conditions: Typically flash-frozen aliquots at -80°C

Table 5: Quality Control Parameters for Recombinant Mouse Ndufb3

ParameterMethodAcceptance CriteriaFrequency
PuritySDS-PAGE>95%Every batch
IdentityWestern blotSingle band at expected MWEvery batch
Mass confirmationMass spectrometryWithin 0.5 Da of theoretical massRepresentative batches
Secondary structureCircular dichroismConsistent with reference spectrumRepresentative batches
AggregationDLS<10% aggregatesEvery batch
EndotoxinLAL test<0.1 EU/μg proteinEvery batch
Functional activityComplex I activity assay>80% of reference activityEvery batch
StabilityAccelerated stability study<10% degradation after 1 month at 4°CAnnually

Careful attention to these parameters ensures that recombinant mouse Ndufb3 used in research is of consistent quality and produces reliable experimental results.

How can researchers troubleshoot inconsistent results in Ndufb3 functional assays?

Troubleshooting inconsistent results in Ndufb3 functional assays requires systematic evaluation of multiple experimental factors:

  • Sample preparation issues:

    • Mitochondrial isolation quality: Inconsistent isolation can affect Complex I integrity

      • Solution: Standardize isolation protocol and verify mitochondrial purity by western blotting

    • Protein degradation: Ndufb3 may degrade during preparation

      • Solution: Add protease inhibitors throughout and maintain samples at 4°C

    • Oxidation of critical residues: Can occur during preparation

      • Solution: Work under nitrogen atmosphere or add reducing agents

  • Assay condition variables:

    • Temperature fluctuations: Affect enzyme kinetics

      • Solution: Use temperature-controlled chamber with pre-equilibration

    • pH inconsistencies: Alter protein conformation and activity

      • Solution: Prepare fresh buffers and verify pH before each experiment

    • Substrate quality: NADH oxidation can occur in storage

      • Solution: Prepare fresh substrate solutions and protect from light

  • Detection method limitations:

    • Instrument calibration: Drift in spectrophotometer readings

      • Solution: Calibrate instruments regularly and include standard curves

    • Signal-to-noise ratio: Poor sensitivity for small changes

      • Solution: Optimize protein concentration and reaction conditions

    • Interference from sample components: Can affect fluorescence/absorbance

      • Solution: Include appropriate blanks and controls

  • Biological variability sources:

    • Cell passage number: Affects mitochondrial content and function

      • Solution: Use cells within a defined passage range

    • Confluency differences: Alter metabolic state

      • Solution: Standardize seeding density and harvest at consistent confluency (40-50%)

    • Media composition variations: Impact cellular metabolism

      • Solution: Use media from same lot and prepare consistently

  • Data analysis considerations:

    • Normalization method: Different approaches yield different results

      • Solution: Use consistent normalization (e.g., to citrate synthase activity)

    • Statistical approach: Affects interpretation of variability

      • Solution: Apply appropriate statistical tests based on data distribution

    • Outlier identification: Subjective removal can bias results

      • Solution: Use objective criteria for outlier identification

Systematic Troubleshooting Protocol:

  • Validate reagents and equipment:

    • Check antibody specificity with positive and negative controls

    • Verify equipment calibration and performance

    • Test fresh reagents against previous batches

  • Isolate variables sequentially:

    • Change one condition at a time to identify problematic variables

    • Include internal controls across experiments

    • Compare results across different operators if possible

  • Implement standardized workflows:

    • Develop detailed standard operating procedures (SOPs)

    • Include quality control checkpoints throughout protocols

    • Maintain consistent timing between experimental steps

  • Document extensively:

    • Record all experimental conditions and deviations

    • Maintain detailed lab notes on environmental factors

    • Track reagent lots and preparation dates

By systematically addressing these factors, researchers can improve reproducibility in Ndufb3 functional assays, leading to more reliable experimental outcomes and interpretations.

What emerging technologies can enhance our understanding of Ndufb3's role in mitochondrial function?

Several cutting-edge technologies are poised to revolutionize our understanding of Ndufb3's function within the mitochondrial landscape:

  • Cryo-electron microscopy advancements:

    • High-resolution structures of intact Complex I with Ndufb3 in different functional states

    • Time-resolved structural changes during electron transport

    • Visualization of interactions between Ndufb3 and other Complex I subunits

    • Structural impacts of disease-associated mutations

  • Single-cell mitochondrial profiling:

    • Mitochondrial-targeted transcriptomics to assess heterogeneity in Ndufb3 expression

    • Single-cell proteomics to correlate Ndufb3 protein levels with mitochondrial function

    • Spatial transcriptomics to map Ndufb3 expression patterns within tissues

    • Correlation of Ndufb3 levels with single-cell metabolomics profiles

  • Live-cell imaging innovations:

    • Super-resolution microscopy of tagged Ndufb3 within the mitochondrial network

    • Real-time monitoring of Ndufb3 incorporation into Complex I

    • Simultaneous visualization of Ndufb3 localization and mitochondrial ROS production

    • FRET-based sensors to detect Ndufb3 interactions and conformational changes

  • Mitochondrial-specific CRISPR technologies:

    • Precise genome editing of Ndufb3 in mitochondrial DNA

    • Base editing to introduce specific mutations without double-strand breaks

    • Inducible and reversible knockdown systems for temporal control

    • Tissue-specific Ndufb3 manipulation in animal models

  • Advanced computational approaches:

    • Molecular dynamics simulations of Ndufb3 within Complex I

    • Machine learning analysis of Ndufb3 expression patterns across diseases

    • Systems biology integration of multi-omics data to position Ndufb3 in metabolic networks

    • Predictive modeling of Ndufb3 mutations' functional impacts

  • Innovative model systems:

    • Mitochondrial organoids for studying Ndufb3 in tissue-specific contexts

    • Patient-derived induced pluripotent stem cells (iPSCs) with Ndufb3 mutations

    • Humanized mouse models expressing human NDUFB3 variants

    • Microphysiological systems ("organs-on-chips") to study tissue-specific functions

These emerging technologies will enable researchers to address fundamental questions about Ndufb3's precise role in mitochondrial function, its contribution to disease pathogenesis, and its potential as a therapeutic target in mitochondrial disorders and cancer.

What are the unexplored aspects of Ndufb3's role in cell signaling and metabolic regulation?

Despite significant advances in understanding Ndufb3's role in mitochondrial function, several aspects of its involvement in cellular signaling and metabolic regulation remain unexplored:

  • Retrograde signaling pathways:

    • How Ndufb3 dysfunction triggers nuclear responses

    • Potential role in mitochondrial-to-nuclear stress signaling

    • Involvement in transcriptional adaptation to mitochondrial dysfunction

    • Impact on epigenetic modifications in response to metabolic stress

  • Post-translational modifications:

    • Identification of Ndufb3 phosphorylation, acetylation, or ubiquitination sites

    • Regulatory enzymes controlling these modifications

    • Functional consequences of modifications on Complex I activity

    • Integration of Ndufb3 modifications with cellular signaling networks

  • Interaction with metabolic sensors:

    • Potential crosstalk with AMPK signaling pathway

    • Relationship with mTOR-mediated metabolic regulation

    • Role in nutrient-sensing mechanisms

    • Involvement in metabolic adaptation to environmental stressors

  • Non-canonical functions beyond Complex I:

    • Potential moonlighting roles outside respiratory complex assembly

    • Involvement in mitochondrial DNA maintenance or expression

    • Possible roles in mitochondrial quality control pathways

    • Participation in mitochondrial-derived vesicle formation

  • Tissue-specific metabolic roles:

    • Differential importance across tissues with varying metabolic demands

    • Specialized functions in highly oxidative tissues versus glycolytic tissues

    • Developmental regulation during tissue specification

    • Sex-specific differences in expression and function

  • Integration with whole-body metabolism:

    • Role in systemic metabolic homeostasis

    • Contribution to exercise response and adaptation

    • Involvement in circadian regulation of mitochondrial function

    • Potential role in aging-related metabolic decline

Research methodologies to explore these aspects could include:

  • Phosphoproteomics and other PTM analyses of Ndufb3 under various conditions

  • Interactome studies using BioID or proximity labeling approaches

  • Conditional tissue-specific knockout models to assess tissue-dependent functions

  • Integration of multi-omics datasets to position Ndufb3 in broader metabolic networks

  • Real-time metabolic flux analysis combined with Ndufb3 manipulation

  • Analysis of Ndufb3's contribution to mitochondrial-derived vesicle composition and function

Exploring these aspects will provide a more comprehensive understanding of how Ndufb3 contributes to cellular homeostasis beyond its structural role in Complex I, potentially revealing new therapeutic targets for mitochondrial disorders and metabolic diseases.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.