Recombinant Mouse NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 (Ndufb4)

Shipped with Ice Packs
In Stock

Description

Overview

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 (Ndufb4) is a protein that functions as a subunit of the NADH:ubiquinone oxidoreductase, also known as Complex I. Complex I is the first enzyme complex found in the mitochondrial electron transport chain . Ndufb4 is a non-catalytic subunit of Complex I, which is a multi-subunit enzyme . Mammalian Complex I consists of approximately 45 different subunits and facilitates the transfer of electrons from NADH to ubiquinone .

Ndufb4 encodes for a protein of 15kDa .

Function

Ndufb4 has NADH dehydrogenase (ubiquinone) activity .

Pathways Involved

Ndufb4 is involved in several pathways, including :

  • Oxidative phosphorylation

  • Metabolic pathways

  • Non-alcoholic fatty liver disease (NAFLD)

Interactions

Ndufb4 interacts directly with several proteins and molecules, including NDUFS4, NDUFS5, NDUFS3, MME, NDUFV1, NDUFA6, NDUFA9, LRRK2, NDUFA11, TIMMDC1, and NDUFA12 .

Clinical Significance

Research indicates a potential role for Ndufb4 in disease. For example, NDUFS4, which interacts with Ndufb4, regulates cristae remodeling in diabetic kidney disease . Studies in mouse models have shown that NDUFS4 can affect mitochondrial function in kidney podocytes and that diabetic podocyte-specific Ndufs4 transgenic mice exhibit improved Complex I activity .

Additionally, a study found that a mutation in NDUFA4 (NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 4) is linked to the development of diabetes in a rodent model . Another study identified NDUFA4L2 as a molecular target for clear cell renal cell carcinoma (ccRCC) treatment .

Table of Related Proteins and Their Functions

FunctionRelated Protein
NADH dehydrogenase (ubiquinone) activityNDUFA1, NDUFB1, NDUFA5, NDUFS1, NDUFB10, NDUFA9, NDUFA7, NDUFB5, NDUFS6, NDUFAF2

Table of Pathways and Related Proteins

Pathway NamePathway Related Protein
Huntingtons diseaseCREB3L3, NDUFA4, ATP5J, HIP1, DNAI2, SP1, COX7A2L, PPARG, TFAM, SOD2
Non-alcoholic fatty liver disease (NAFLD)TRAF2, SDHC, PRKAA1, NDUFV3, BAX, ADIPOR2, MAPK10, PRKAG3, GSK3A, NDUFS3
Oxidative phosphorylationATP5G1, ATP6V0E, COX6B2, ATP6V0A1A, ATP6V0C, ATP6AP2, NDUFA9, ATP6V1B1, NDUFS4, ATP6V1C1
Metabolic pathwaysPOLR2A, FUT6, G6PC, CYP4F14, UCK2B, HSD17B12, PNLIPRP1, GPAT2, ATP6V1E1, POLR3G
Parkinsons diseaseAtp5g2, HTRA2, UBE2J2, SLC18A2, NDUFA4L2, COX5A, ATP5D, COX7A1, SLC6A3, SLC25A6
Alzheimers diseaseNDUFS2, GRIN2C, MAPK1, IDE, PSEN1, NDUFS8, COX7A1, UQCRQ, NDUFB7, NDUFB11

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Ndufb4; NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4; Complex I-B15; CI-B15; NADH-ubiquinone oxidoreductase B15 subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-129
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
SGSKYKPAPLATLPSTLDPAEYDVSPETRRAQVERLSIRARLKREYLLQYNDPKRVSHIE DPALIRWTYARSANIYPNFRPTPKNSLLGAVAGFGPLIFWYYVFKTDRDRKERLIQEGKL DRKFNISY
Uniprot No.

Target Background

Function

Recombinant Mouse NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 (Ndufb4) is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is believed not to be directly involved in catalysis. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone considered the immediate electron acceptor.

Database Links
Protein Families
Complex I NDUFB4 subunit family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein; Matrix side.

Q&A

What is the basic structure and function of mouse Ndufb4?

Mouse Ndufb4 is a subunit of NADH dehydrogenase (ubiquinone), located in the mitochondrial inner membrane and is a component of Complex I of the electron transport chain. The protein is structurally characterized by an N-terminal hydrophobic domain capable of forming an alpha helix that spans the inner mitochondrial membrane, and a C-terminal hydrophilic domain that interacts with globular subunits of Complex I. This highly conserved two-domain structure suggests critical functionality, primarily serving as an anchor for the NADH dehydrogenase complex at the inner mitochondrial membrane .

What expression systems are most effective for producing recombinant mouse Ndufb4?

For recombinant mouse Ndufb4 production, bacterial expression systems such as E. coli can be utilized for basic structural studies, but often yield inclusion bodies requiring refolding due to the protein's hydrophobic domains. Mammalian expression systems (particularly mouse or Chinese hamster ovary cells) generally provide better results for functional studies as they offer appropriate post-translational modifications and membrane integration capabilities. For high-yield production with proper folding, baculovirus-infected insect cell systems represent an optimal compromise, allowing for large-scale production while maintaining proper protein conformation.

When expressing Ndufb4, consider including a fusion tag (His, GST, or FLAG) for purification, preferably with a cleavable linker to remove the tag if it interferes with functional studies. Expression conditions must be carefully optimized to balance protein yield with proper folding, especially given the transmembrane nature of this protein.

What purification strategies work best for recombinant mouse Ndufb4?

When purifying recombinant mouse Ndufb4, a multi-step approach is recommended due to its hydrophobic domains:

  • Initial extraction using mild detergents (DDM, CHAPS, or digitonin) to solubilize membrane-associated protein without denaturing

  • Affinity chromatography (if tagged) as the primary purification step

  • Ion exchange chromatography to remove contaminants with different charge properties

  • Size exclusion chromatography as a final polishing step

The purification buffer should maintain protein stability by including:

  • 20-50 mM phosphate or Tris buffer (pH 7.0-8.0)

  • 100-300 mM NaCl to prevent aggregation

  • 5-10% glycerol as a stabilizing agent

  • 0.03-0.1% detergent (concentration below critical micelle concentration)

  • 1-5 mM reducing agent (DTT or β-mercaptoethanol)

  • Protease inhibitors to prevent degradation

Successful purification should be validated through Western blotting, mass spectrometry, and activity assays to confirm identity and integrity.

How can researchers effectively study Ndufb4's role in Complex I assembly?

To investigate Ndufb4's role in Complex I assembly, researchers should implement a multi-faceted approach:

  • Knockdown/Knockout Studies: Utilize CRISPR-Cas9 or siRNA technologies to reduce or eliminate Ndufb4 expression in mouse cell lines, then assess Complex I assembly via Blue Native PAGE and immunoblotting.

  • Interaction Mapping: Employ co-immunoprecipitation with tagged Ndufb4 followed by mass spectrometry to identify interaction partners during various stages of Complex I assembly.

  • Time-course Assembly Assays: Use pulse-chase labeling with incorporation of radioactive amino acids or click chemistry to track newly synthesized Ndufb4 during mitochondrial biogenesis.

  • Structure-function Analysis: Create a panel of Ndufb4 mutants with modifications to key domains to determine which regions are critical for proper integration into Complex I.

  • Complementation Assays: Rescue Ndufb4-deficient cells with wild-type or mutant versions of recombinant mouse Ndufb4 to assess functional recovery of Complex I.

When interpreting results, researchers should consider that complete absence of Ndufb4 may affect the assembly of other complex I subunits, potentially leading to indirect effects that complicate data interpretation.

What are the most reliable methods to assess Ndufb4 incorporation into the respiratory chain?

To reliably assess Ndufb4 incorporation into the respiratory chain, researchers should employ multiple complementary techniques:

  • Blue Native Polyacrylamide Gel Electrophoresis (BN-PAGE): This technique preserves protein complexes in their native state and can be followed by:

    • In-gel activity assays using NADH and electron acceptors

    • Western blotting to identify specific subunits within the complex

    • Second-dimension SDS-PAGE to separate individual subunits while maintaining information about their complex association

  • Immunocytochemistry with Super-resolution Microscopy: Allows visualization of Ndufb4 colocalization with other Complex I components in intact mitochondria.

  • Protease Protection Assays: Can determine the topology and membrane insertion of Ndufb4 within the mitochondrial inner membrane.

  • Crosslinking Mass Spectrometry: Identifies precise interaction points between Ndufb4 and neighboring subunits within Complex I.

  • Respirometry: Measures functional incorporation by assessing Complex I-driven respiration in systems with wild-type versus modified Ndufb4.

For quantitative assessment, researchers should develop standard curves using known quantities of purified recombinant protein and validate antibody specificity using appropriate knockout controls.

How should researchers interpret conflicting data regarding Ndufb4 function in different experimental systems?

When encountering conflicting data on Ndufb4 function across different experimental systems, researchers should systematically analyze potential sources of variation:

  • Experimental System Differences: Cell lines, primary cultures, and animal models may exhibit different compensatory mechanisms in response to Ndufb4 manipulation. Document specific characteristics of each system, including:

    • Metabolic state and reliance on oxidative phosphorylation

    • Expression levels of other Complex I subunits

    • Presence of tissue-specific isoforms or splice variants

  • Technical Variables: Variations in experimental techniques can lead to apparent contradictions:

    • Antibody specificity and epitope accessibility

    • Protein extraction methods affecting membrane protein recovery

    • Assay sensitivity and dynamic range

  • Data Normalization Approaches: Different normalization strategies can yield seemingly conflicting results. Compare:

    • Normalization to total protein vs. specific mitochondrial markers

    • Relative vs. absolute quantification methods

  • Temporal Considerations: Acute vs. chronic manipulation of Ndufb4 may trigger different adaptive responses. Design time-course experiments to distinguish immediate effects from compensatory adaptations.

  • Genetic Background Effects: For mouse studies, document strain differences that may influence phenotypic outcomes of Ndufb4 manipulation.

To resolve discrepancies, design experiments that directly compare systems under identical conditions and consider collaborations to validate findings across multiple laboratories.

How can recombinant mouse Ndufb4 be used to study mitochondrial dysfunction in disease models?

Recombinant mouse Ndufb4 offers valuable applications for studying mitochondrial dysfunction in various disease models:

  • Structural Studies: Purified recombinant Ndufb4 can be used for structural analysis via X-ray crystallography or cryo-EM to identify disease-relevant conformational changes.

  • Rescue Experiments: Introducing wild-type recombinant Ndufb4 into cells with dysfunctional endogenous protein can determine if restoring proper Ndufb4 function ameliorates mitochondrial defects.

  • Interaction Screening: Using recombinant Ndufb4 as bait in pull-down assays can identify altered protein-protein interactions in disease states.

  • Antibody Generation: Purified recombinant protein serves as an antigen for developing specific antibodies needed for diagnostic and research applications.

  • In Vitro Complex I Assembly: Recombinant Ndufb4 can be incorporated into in vitro Complex I assembly systems to study the impact of mutations or post-translational modifications on complex formation.

When designing these experiments, researchers should include appropriate controls with mutated forms of Ndufb4 known to cause dysfunction in humans, as related NDUFS4 mutations have been implicated in conditions like Leigh syndrome .

Is there evidence linking Ndufb4 to cancer progression similar to other Complex I subunits?

While direct evidence linking mouse Ndufb4 to cancer progression is limited, research on related Complex I subunits provides compelling reasons to investigate this connection. For instance, NDUFS4 (another Complex I subunit) has been shown to promote tumor progression in gastric cancer models, with high expression associated with terminal TNM stage and unfavorable survival outcomes. Studies have demonstrated that downregulation of NDUFS4 decreased cancer cell proliferation, migration, and invasion, suggesting potential therapeutic targeting .

For researchers investigating potential Ndufb4 involvement in cancer:

  • Expression Analysis: Compare Ndufb4 expression levels across normal tissues and various cancer types using techniques such as qRT-PCR, Western blotting, and immunohistochemistry.

  • Functional Studies: Manipulate Ndufb4 expression in cancer cell lines to assess effects on:

    • Proliferation and cell cycle progression

    • Migration and invasion capabilities

    • Metabolic reprogramming

    • Response to chemotherapeutic agents

  • Prognostic Correlation: Analyze patient data to determine if Ndufb4 expression correlates with clinical outcomes, similar to the approach used for NDUFS4 in gastric cancer .

When designing these studies, consider that alterations in Complex I function may affect cancer progression through multiple mechanisms, including changes in reactive oxygen species production, metabolic reprogramming, and apoptotic resistance.

What are the optimal conditions for assessing Ndufb4 activity within Complex I?

To optimally assess Ndufb4's contribution to Complex I activity, researchers should implement the following conditions and controls:

  • Sample Preparation:

    • Use freshly isolated mitochondria rather than frozen samples

    • Maintain physiological pH (7.2-7.4) and temperature (37°C for mammalian studies)

    • Include protease inhibitors to prevent degradation

    • Avoid harsh detergents that might disrupt Complex I integrity

  • Activity Measurement Techniques:

    • NADH:ubiquinone oxidoreductase activity assays

    • Oxygen consumption measurements using high-resolution respirometry

    • Membrane potential assessments using potential-sensitive dyes

    • ROS production measurements as an indicator of Complex I efficiency

  • Essential Controls:

    • Specific Complex I inhibitors (rotenone, piericidin A) to confirm activity specificity

    • Comparisons with samples lacking Ndufb4 or containing mutated versions

    • Parallel assessment of other respiratory chain complexes to ensure specificity

    • Internal normalization to mitochondrial content markers

  • Data Interpretation:

    • Account for possible compensatory upregulation of other Complex I subunits

    • Consider changes in mitochondrial content when interpreting activity changes

    • Distinguish between effects on assembly versus catalytic activity

Since Ndufb4 is a non-catalytic subunit, its contributions to activity are likely structural and regulatory rather than directly enzymatic .

How can researchers accurately quantify the stoichiometry of Ndufb4 within Complex I?

Accurately quantifying Ndufb4 stoichiometry within Complex I requires sophisticated approaches:

  • Absolute Quantification by Mass Spectrometry:

    • Targeted proteomics using selected reaction monitoring (SRM) or parallel reaction monitoring (PRM)

    • Include isotopically labeled standards of Ndufb4 and other Complex I subunits

    • Calculate absolute molar quantities based on labeled reference peptides

  • Biochemical Approaches:

    • Quantitative Western blotting with recombinant protein standards

    • Immunoprecipitation of intact Complex I followed by subunit quantification

    • Radioactive labeling and density analysis

  • Structural Biology Techniques:

    • Cryo-electron microscopy of purified Complex I with subunit identification

    • Crosslinking mass spectrometry to determine spatial relationships

    • Single-molecule imaging techniques to count individual subunits

  • Quality Control Considerations:

    • Verify antibody specificity using knockout controls

    • Ensure complete extraction of membrane-embedded subunits

    • Account for possible substoichiometric incorporation in partially assembled complexes

What new technologies are emerging for studying the dynamic incorporation of Ndufb4 into Complex I?

Several cutting-edge technologies are emerging that will transform our understanding of Ndufb4 incorporation into Complex I:

  • Live-Cell Imaging Approaches:

    • CRISPR-mediated endogenous tagging with fluorescent proteins

    • Split fluorescent protein complementation to visualize assembly events

    • Single-molecule tracking of labeled Ndufb4 during incorporation

  • Time-Resolved Structural Biology:

    • Time-resolved cryo-EM to capture assembly intermediates

    • Hydrogen-deuterium exchange mass spectrometry to monitor conformational changes

    • Integrative structural biology combining multiple data types

  • Advanced Genetic Tools:

    • Inducible degradation systems for temporal control of Ndufb4 levels

    • Base editing for precise modification of key residues without complete knockout

    • Tissue-specific and conditional manipulation in animal models

  • Metabolic Tracing:

    • Stable isotope labeling combined with metabolomics to track metabolic consequences

    • Real-time monitoring of respiration in response to acute Ndufb4 manipulation

  • System-Level Analysis:

    • Multi-omics integration (transcriptomics, proteomics, metabolomics)

    • Mathematical modeling of Complex I assembly incorporating Ndufb4 dynamics

    • Machine learning approaches to identify patterns in large-scale datasets

Researchers should consider interdisciplinary collaborations to leverage these technologies effectively, as they often require specialized expertise beyond traditional biochemical approaches.

How might post-translational modifications of Ndufb4 affect Complex I function?

Post-translational modifications (PTMs) of Ndufb4 likely play crucial regulatory roles in Complex I function that remain largely unexplored:

  • Common PTMs to Investigate:

    • Phosphorylation: The related subunit NDUFS4 contains phosphorylation sites that regulate Complex I activity

    • Acetylation: Often responsive to metabolic state and mitochondrial acetyl-CoA levels

    • Ubiquitination: May regulate Ndufb4 turnover and quality control

    • Oxidative modifications: Could serve as sensors for oxidative stress

  • Experimental Approaches:

    • Site-directed mutagenesis of putative modification sites

    • Mass spectrometry-based PTM mapping under various physiological conditions

    • Pharmacological manipulation of modifying enzymes

    • Generation of modification-specific antibodies

  • Functional Consequences to Assess:

    • Complex I assembly efficiency and stability

    • NADH:ubiquinone oxidoreductase activity

    • Supercomplex formation with other respiratory chain components

    • Response to cellular stressors and metabolic changes

  • Regulatory Mechanisms:

    • Identify kinases, phosphatases, acetyltransferases, and deacetylases that target Ndufb4

    • Determine signaling pathways that converge on Ndufb4 modification

    • Assess cross-talk between different modifications

When designing these studies, researchers should consider that PTMs may occur substoichiometrically and transiently, requiring sensitive detection methods and careful experimental timing.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.