Recombinant Mouse NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 (Ndufb6)

Shipped with Ice Packs
In Stock

Description

Overview of Ndufb6

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 (Ndufb6) is a protein that functions as a subunit of the NADH:ubiquinone oxidoreductase, also known as complex I . In mammals, complex I is composed of 45 different subunits and is located in the mitochondrial inner membrane . Ndufb6 participates in the transfer of electrons from NADH to the respiratory chain, acting as an NADH dehydrogenase and oxidoreductase . Ubiquinone is believed to be the immediate electron acceptor for this enzyme . Alternative splicing at the NDUFB6 locus results in three transcript variants encoding distinct isoforms .

Synonyms:

  • NDUFB6

  • NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6, 17kDa

  • NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 6

  • B17 subunit

  • Complex I mitochondrial respiratory chain B17 subunit

Function

Ndufb6 has NADH dehydrogenase (ubiquinone) activity .

Table 1: Proteins with similar function as Ndufb6

FunctionRelated Protein(s)
NADH dehydrogenase (ubiquinone) activityNDUFS4, NDUFS1, NDUFS8, NDUFAB1, NDUFB8, NDUFS6, NDUFB2, NDUFS3, NDUFB4, NDUFS7

Interactions

Ndufb6 interacts directly with several proteins and molecules, as detected by methods such as yeast two-hybrid, co-IP, and pull-down assays .

Table 2: Interacting Proteins

Interacting Protein(s)
TMBIM4, NDUFS5, NDUFS3, NDUFA6, NDUFA11, Kif19, TIMMDC1, NDUFA12, NDUFAF1

Involvement in Pathways

Ndufb6 is involved in various pathways .

Table 3: Pathways involving Ndufb6

Pathway NamePathway Related Protein(s)
Huntington's diseaseAPAF1, TBPL2, PLCB2, BDNF, TAF4B, SLC25A4, POLR2K, NDUFA10, GRIN1, SOD1
Metabolic pathwaysCD38, ACSL5, PCCA, AGL, PCK1, TK2, MAN1A2, HGD, ADH4, ALDH3B1
Alzheimer's diseaseIL1B2, UQCR10, NDUFB7, GRIN2A, CALM4, NDUFA2, IDE, UQCRFS1, FAS, NDUFA6
Non-alcoholic fatty liver disease (NAFLD)MAP3K5, RAC1, NDUFC2, NDUFA12, COX8C, Fasl, UQCR10, SDHA, NDUFS2, ERN1
Parkinson's diseaseNDUFA10, PARK7, ATP5A1, NDUFAB1, Atp5g2, SLC25A5, NDUFB10, NDUFS8, UBE1Y1, MT-ND1
Oxidative phosphorylationATP5B, COX10, NDUFS3, UQCRC2A, NDUFB10, COX17, ATP6V1G1, COX15, ATP5IA, SDHC

Clinical Significance

NDUFB6 expression is reduced in muscle tissue of individuals with type 2 diabetes (T2DM) compared to healthy individuals, which is significant because complex I plays a crucial role in regulating oxidative phosphorylation . Polymorphisms in the NDUFB6 gene have been shown to modulate responses to exercise in patients with T2DM .

A study found that the NDUFB6 rs540467 single nucleotide polymorphism (SNP) modifies physical activity (PA)-mediated changes in insulin sensitivity, body composition, and liver fat estimates in type 2 diabetes . Individuals with T2DM carrying the G/G genotype of the NDUFB6 SNP rs540467 showed a positive correlation between changes in M-value (a measure of insulin sensitivity) and PA levels, while carriers of the A-allele did not show such an association . Additionally, a decrease in waist circumference and fatty liver index (FLI) with increasing PA was observed in T2D individuals carrying the G/G allele, but not in A-allele carriers .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment based on availability.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag is required, please inform us, and we will prioritize its inclusion.
Synonyms
Ndufb6; Gm137; NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6; Complex I-B17; CI-B17; NADH-ubiquinone oxidoreductase B17 subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-128
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
SGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPRRMWPLERFWDNFLRDGAVWKNMV FKAYRSSLFAVSHVLIPMWFVHYYVKYHMATKPYTIVSSKPRIFPGDTILETGEVIPPMR DFPDQHH
Uniprot No.

Target Background

Function

Recombinant Mouse NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 (Ndufb6) is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is not believed to be directly involved in catalysis. Complex I facilitates the transfer of electrons from NADH to the respiratory chain, with ubiquinone thought to be its immediate electron acceptor.

Database Links
Protein Families
Complex I NDUFB6 subunit family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein; Matrix side.

Q&A

What is the structure of mouse Ndufb6 protein and how does it compare to human NDUFB6?

Mouse Ndufb6, like its human counterpart, is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). The protein has a molecular weight of approximately 15.5-17 kDa and consists of 128 amino acids . The structure features an N-terminal hydrophobic domain that can fold into an alpha helix spanning the inner mitochondrial membrane, along with a C-terminal hydrophilic domain that interacts with globular subunits of Complex I . This highly conserved two-domain structure is critical for protein function, with the hydrophobic domain serving as an anchor for the NADH dehydrogenase complex at the inner mitochondrial membrane .

Where is Ndufb6 localized within mitochondria and how is this determined experimentally?

Ndufb6 is specifically localized to the inner mitochondrial membrane . This localization can be experimentally verified through:

  • Subcellular fractionation of mitochondria followed by Western blot analysis

  • Immunofluorescence microscopy using specific anti-Ndufb6 antibodies

  • Electron microscopy with immunogold labeling

When designing experiments to study Ndufb6 localization, researchers should consider using multiple complementary techniques to confirm results, as each method has specific limitations and advantages for membrane protein detection .

What antibodies and protocols are recommended for detecting mouse Ndufb6 in experimental samples?

Several validated antibodies are available for mouse Ndufb6 detection with specific application recommendations:

Recommended Antibodies and Applications:

Antibody TypeApplicationsRecommended DilutionValidated SamplesSource
Rabbit PolyclonalWB, IHC, ELISAWB: 1:1000-1:4000
IHC: 1:50-1:500
Mouse skeletal muscle tissue
Rabbit PolyclonalWB, ELISAWB: 1:200-1:2000Mouse skeletal muscle tissue

Experimental Protocol Considerations:

  • For Western blot detection, the observed molecular weight is typically 16-20 kDa

  • For immunohistochemistry, antigen retrieval with TE buffer pH 9.0 is recommended

  • Sample-dependent optimization is crucial as detection efficiency may vary by tissue type

How can subcomplexes containing Ndufb6 be isolated and characterized?

Isolation and characterization of Ndufb6-containing subcomplexes can be achieved through:

  • Blue Native Polyacrylamide Gel Electrophoresis (BN-PAGE):

    • This technique allows separation of intact respiratory chain complexes while preserving their native structures

    • Subcomplexes containing Ndufb6 can be identified through immunoblotting with specific antibodies after BN-PAGE separation

  • Two-dimensional BN-PAGE/SDS-PAGE:

    • First dimension: BN-PAGE to separate intact complexes

    • Second dimension: SDS-PAGE to separate individual subunits

    • This approach enables identification of Ndufb6-containing subcomplexes and their composition

  • Immunoprecipitation with Ndufb6-specific antibodies:

    • Allows pull-down of Ndufb6 and its interaction partners

    • Mass spectrometry analysis of the immunoprecipitated material can identify specific subunits present in the subcomplexes

Research has shown that following depletion of other Complex I subunits such as NDUFS3, accumulation of subcomplexes containing Ndufb6 can be observed, indicating its stability and potential role in Complex I assembly intermediates .

How does Ndufb6 contribute to Complex I assembly and which module is it associated with?

Recent research has definitively assigned Ndufb6 to the ND4-module of Complex I . This assignment was initially uncertain, but proteomics analyses have confirmed that Ndufb6 interacts in an early subassembly with NDUFB5, NDUFB10, and NDUFB11, all subunits belonging to the ND4-module .

The assembly process of Complex I follows a modular pathway, with different modules assembling independently before joining together. Ndufb6's role in this process includes:

  • Early incorporation into the ND4-module assembly intermediate

  • Stabilization of the membrane arm of Complex I

  • Facilitation of proper module integration during later assembly stages

The experimental evidence for Ndufb6's module assignment comes from proteomic analysis of Complex I assembly intermediates that accumulate following progressive depletion of other subunits . These findings have important implications for understanding mitochondrial diseases associated with Complex I deficiency.

What happens to Ndufb6 stability when other Complex I subunits are depleted?

Unlike many other Complex I subunits, Ndufb6 demonstrates remarkable stability even when key Complex I subunits are depleted. In studies where NDUFS3 (a core subunit of Complex I) was progressively repressed:

  • Subunits belonging to the N- and Q-modules (NDUFA12 and NDUFS6) rapidly decreased

  • NDUFB8 (ND5-module) and NDUFA9 showed moderate reduction

  • Ndufb6 levels remained consistently stable even after virtually complete NDUFS3 repression

This stability pattern provides valuable insight into Complex I assembly dynamics. The reduction of NDUFS3 was followed by progressive decrease of fully assembled Complex I and accumulation of subcomplexes containing NDUFB8 and NDUFB6, while other respiratory complexes (III and IV) were not affected .

How can recombinant Ndufb6 be used to study Complex I-related mitochondrial diseases?

Recombinant Ndufb6 offers several valuable applications for studying Complex I-related diseases:

  • Structural studies:

    • Recombinant Ndufb6 can be used in crystallography or cryo-EM studies to understand the structural basis of Complex I assembly defects

    • Site-directed mutagenesis of recombinant Ndufb6 can help identify critical residues for function and assembly

  • Protein-protein interaction studies:

    • Pull-down assays using tagged recombinant Ndufb6 can identify interaction partners

    • Changes in these interactions in disease models can reveal pathological mechanisms

  • Reconstitution experiments:

    • Adding recombinant Ndufb6 to Ndufb6-deficient mitochondrial preparations can assess functional rescue

    • This approach can test the functional impact of specific mutations identified in patients

  • Antibody production:

    • Recombinant Ndufb6 serves as an excellent immunogen for generating specific antibodies

    • These antibodies enable detection of endogenous Ndufb6 in patient samples or disease models

In mitochondrial disease research, particularly conditions like Leigh Syndrome associated with Complex I deficiency, recombinant Ndufb6 can provide critical insights into assembly defects that may not be apparent through study of catalytic subunits alone .

What are the optimal conditions for expressing and purifying recombinant mouse Ndufb6?

Optimizing expression and purification of recombinant mouse Ndufb6 requires careful consideration of its membrane protein characteristics:

Expression Systems:

  • Bacterial expression: Use E. coli strains optimized for membrane protein expression (e.g., C41(DE3), C43(DE3))

  • Eukaryotic expression: Consider HEK293 or insect cell systems for proper post-translational modifications

Purification Protocol:

  • Solubilize membrane fractions using mild detergents like n-Dodecyl β-D-maltoside (DDM) or digitonin

  • Utilize affinity tags (His-tag, GST-tag) positioned to avoid disrupting protein folding

  • Consider detergent exchange during purification to maintain protein stability

  • Validate proper folding through circular dichroism or limited proteolysis

Critical Considerations:

  • The hydrophobic N-terminal domain may cause aggregation; consider using fusion partners to enhance solubility

  • The small size (15.5-17 kDa) may lead to poor expression or detection; optimize codons for the expression system

  • Confirm proper folding through functional assays measuring interaction with known binding partners

Why might Western blot detection of Ndufb6 vary between different tissues and how can this be optimized?

Variability in Ndufb6 detection across tissues can result from multiple factors:

Sources of Variability:

  • Differential expression levels: Mitochondrially-rich tissues (muscle, heart) typically show higher expression

  • Presence of post-translational modifications: These may vary by tissue and affect epitope recognition

  • Matrix effects: Different tissue compositions can interfere with extraction efficiency

  • Subcellular distribution: Proportional differences in mitochondrial content affect total protein yield

Optimization Strategies:

ChallengeOptimization Approach
Low signalIncrease antibody concentration (1:200-1:800)
High backgroundUse more stringent washing and longer blocking times
Multiple bandsTry alternative antibodies targeting different epitopes
Tissue-specific issuesOptimize extraction buffers for each tissue type

Validation data indicates successful detection in mouse skeletal muscle tissue with observed molecular weight of 16-17 kDa using specific antibody dilutions . For particularly challenging tissues, consider enriching mitochondrial fractions before immunoblotting to increase detection sensitivity.

How can researchers effectively study interactions between Ndufb6 and other Complex I subunits?

Studying Ndufb6 interactions with other Complex I components requires specialized approaches:

  • Proximity-based labeling techniques:

    • BioID or APEX2 fusion proteins can identify proteins in close proximity to Ndufb6 within the mitochondrial membrane

    • These approaches are particularly valuable for identifying transient interactions during Complex I assembly

  • Crosslinking mass spectrometry:

    • Chemical crosslinking followed by mass spectrometry analysis can capture direct protein-protein interactions

    • This approach can map the specific residues involved in subunit interactions

  • Co-immunoprecipitation with specialized detergents:

    • Digitonin or other mild detergents preserve native protein complexes

    • Sequential immunoprecipitation with antibodies against different subunits can reveal assembly intermediates

  • Genetic approaches:

    • CRISPR/Cas9-mediated tagging of endogenous Ndufb6 and other subunits

    • Conditional knockout models to study assembly dynamics in the absence of specific subunits

Research has shown that Ndufb6 interacts in an early subassembly with NDUFB5, NDUFB10, and NDUFB11, information that was critical for its definitive assignment to the ND4-module . These interaction studies provide valuable insights into Complex I assembly pathways that may be disrupted in mitochondrial diseases.

What role does Ndufb6 play in mitochondrial dysfunction models and how can it be therapeutically targeted?

Understanding Ndufb6's role in mitochondrial dysfunction provides insights for potential therapeutic approaches:

  • Stability during Complex I deficiency:

    • Ndufb6 remains stable even when other subunits like NDUFS3 are depleted

    • This stability suggests Ndufb6 may serve as a scaffold for rebuilding Complex I function

  • Potential therapeutic avenues:

    • Gene therapy approaches delivering functional Ndufb6 may help stabilize Complex I assembly

    • Small molecules that enhance Ndufb6-mediated interactions could potentially improve Complex I stability

  • Bypass strategies:

    • Similar to the approach with NDI1 (a yeast NADH dehydrogenase) in NDUFS4-deficient mice , alternative electron transfer pathways might bypass Ndufb6-related defects

    • This strategy focuses on restoring NAD+ regeneration capability rather than fixing the structural defect

Current research in mouse models with Complex I deficiencies (like the NDUFS4 knockout model) demonstrates that NAD+ regeneration rescue can improve lifespan , suggesting similar approaches might be beneficial in conditions involving Ndufb6 dysfunction.

How does Ndufb6 expression change in different physiological and pathological conditions?

Ndufb6 expression patterns provide important insights into mitochondrial adaptations:

Physiological Conditions:

  • Tissues with high energy demands (cardiac muscle, skeletal muscle, liver) typically show higher baseline expression of Ndufb6

  • Expression may be upregulated during increased metabolic demand (exercise, cold exposure) as part of mitochondrial biogenesis

Pathological Conditions:

  • In mitochondrial disease models, Ndufb6 expression patterns may remain stable even when other Complex I subunits decrease

  • This differential stability may serve as a diagnostic marker for specific types of Complex I assembly defects

Experimental Approaches for Expression Analysis:

  • qRT-PCR for mRNA quantification across different tissues and conditions

  • Western blot analysis using validated antibodies (dilution 1:1000-1:4000)

  • Immunohistochemistry for spatial distribution analysis (dilution 1:50-1:500)

  • Mass spectrometry-based proteomics for precise quantification and modification analysis

Understanding these expression patterns is crucial for interpreting experimental results and identifying potential therapeutic windows in mitochondrial disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.