Recombinant Mouse NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial (Ndufb8)

Shipped with Ice Packs
In Stock

Description

Biochemical Activity

Ndufb8 is essential for:

  • Complex I Assembly: Acts as a structural scaffold for subunits in the beta subcomplex .

  • Electron Transport: Facilitates NADH-driven electron transfer to ubiquinone .

  • Redox Regulation: Interacts with reactive oxygen species (ROS) and nitric oxide (NO), influencing mitochondrial bioenergetics .

Interacting Proteins

Recombinant Ndufb8 interacts with:

  • Complex I Components: NDUFS4, NDUFS5, NDUFS3, COX6C .

  • Disease-Associated Proteins: CACNA1A (calcium channel), PIM2 (kinase), and RAB7A (trafficking) .

Diagnostic and Functional Assays

ApplicationMethodKey FindingsReference
ImmunohistochemistryAntibody-based detection (e.g., 83216-4-PBS)Loss of Ndufb8 immunoreactivity in Complex I deficiency patients (e.g., Leigh syndrome) .
ELISAQuantitative detection in lysatesSensitivity: <0.05 ng/ml; Test range: 0.156–10 ng/ml .
BN-PAGE AnalysisAssessment of Complex I assemblyReduced fully assembled Complex I in NDUFB8 mutation carriers .

Mechanistic Studies

  • Nitration and Oxidative Stress: Nitric oxide (NO) induces Ndufb8 tyrosine nitration, impairing Complex I activity and triggering necrotic cell death .

  • Respiratory Chain Defects: Mutations (e.g., c.432C>G) cause exon skipping, leading to isolated Complex I deficiency .

Mitochondrial Disorders

  • Leigh Syndrome: Homozygous NDUFB8 mutations (e.g., c.432C>G) cause neonatal encephalopathy, lactic acidosis, and cerebral edema .

  • Complex I Deficiency: Mutations lead to reduced enzymatic activity, as shown in muscle and fibroblasts .

Therapeutic Insights

  • Complementation Studies: Exogenous wild-type Ndufb8 restores Complex I function in patient-derived cells .

  • Antioxidant Interventions: Overexpression of mitochondrial superoxide dismutase (MnSOD) mitigates NO-induced Ndufb8 nitration .

Recombinant Protein and Antibodies

ProductSource/HostApplicationsReactivity
Recombinant Ndufb8E. coliStructural studies, ELISAMouse, human, rat
Rabbit Anti-Ndufb8 AntibodyHEK293WB, IHC, FC, ELISAHuman, mouse, rat

ELISA Kits

  • Mouse Ndufb8 ELISA Kit: Detects native protein in lysates with a sensitivity of <0.05 ng/ml .

Cancer and Metabolic Pathways

  • Cancer Metabolism: NDUFB8 is implicated in oxidative phosphorylation and non-alcoholic fatty liver disease (NAFLD) pathways .

  • Epigenetic Regulation: Roadmap Epigenomics data links NDUFB8 to histone modification profiles in specific cell types .

Diagnostic Challenges

  • Heterogeneous Presentation: Mutations in NDUFB8 may present with normal Ndufb8 immunoreactivity in some cases, necessitating full mitochondrial genome sequencing .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If a specific tag type is required, please inform us, and we will prioritize its implementation.
Synonyms
Ndufb8; NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial; Complex I-ASHI; CI-ASHI; NADH-ubiquinone oxidoreductase ASHI subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
29-186
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
AFHMTKDMLPGSYPRTPEERAAAAKKYNMRVEDYEPYPDDGMGYGDYPMLPNRSQHERDP WYQWDHSELRMNWGEPIHWDLDMYIRNRVDTSPTPVSWDVMCKHLFGFVAFMVFMFWVGH VFPSYQPVGPKQYPYNNLYLERGGDPTKEPEPVVHYDI
Uniprot No.

Target Background

Function
Recombinant Mouse NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial (Ndufb8) is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is not believed to be directly involved in catalysis. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone considered the immediate electron acceptor.
Gene References Into Functions
  1. This study reports mitochondrial dysfunction in the TgCRND8 mouse model of Alzheimer's disease and identifies the NDUFB8 subunit of complex I as a key target of A-beta toxicity. PMID: 24217272
Database Links

KEGG: mmu:67264

STRING: 10090.ENSMUSP00000026222

UniGene: Mm.2060

Protein Families
Complex I NDUFB8 subunit family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein; Matrix side.

Q&A

How does the structure of mouse NDUFB8 compare to human NDUFB8? [Basic]

The mouse NDUFB8 protein shares high structural homology with its human counterpart. Both are approximately 22 kDa proteins composed of around 186 amino acids . The characteristic L-shaped structure with a hydrophobic transmembrane domain and a hydrophilic domain is conserved across species . The N-terminal hydrophobic domain forms an alpha helix that spans the inner mitochondrial membrane, while the C-terminal hydrophilic domain interacts with globular subunits of Complex I . This conservation across species makes mouse models valuable for studying human mitochondrial disorders associated with NDUFB8 dysfunction.

What are the most reliable markers for co-detection when studying NDUFB8 in mitochondrial research? [Advanced]

When studying NDUFB8 in mitochondrial research, VDAC (Voltage-Dependent Anion Channel) serves as the most reliable mitochondrial mass marker for normalization and co-detection . Research data demonstrates a strong linear relationship between VDAC and NDUFB8 protein abundance in healthy tissues, making it an excellent reference point for quantitative analysis . Additionally, other OXPHOS proteins such as CYB and MTCO1 are frequently studied alongside NDUFB8 to provide a comprehensive assessment of mitochondrial function . This multi-marker approach enables researchers to distinguish between global mitochondrial defects and specific Complex I deficiencies.

Mitochondrial MarkerRelationship with NDUFB8Application
VDACStrong linear correlation in healthy tissueNormalization of NDUFB8 expression
CYBParallel analysis for complex comparisonDifferential complex deficiency analysis
MTCO1Parallel analysis for complex comparisonDifferential complex deficiency analysis

What are the optimal antibody dilutions and conditions for Western blotting of mouse NDUFB8? [Basic]

For Western blotting detection of mouse NDUFB8, a dilution of 1:1000 is typically recommended when using commercial antibodies such as the NDUFB8 (E7U3O) Rabbit mAb . The expected molecular weight for detection is approximately 19 kDa on Western blots, which differs slightly from the calculated weight of 22 kDa due to post-translational modifications and migration characteristics . Recombinant antibodies offer superior lot-to-lot consistency compared to traditional antibodies, providing more reliable results across experimental replicates . For optimal results, protein extraction should be performed using buffers that effectively solubilize membrane proteins while preserving native protein structure.

How can researchers effectively quantify NDUFB8 deficiency in mouse tissue samples? [Advanced]

Quantifying NDUFB8 deficiency in mouse tissue samples requires sophisticated analytical approaches. A Bayesian hierarchical mixture model has proven superior to traditional frequentist linear models for classifying OXPHOS-deficient cells . This approach accounts for inter-subject variation in OXPHOS protein abundance that simple linear models cannot accommodate . The method involves:

  • Log-transformation of protein abundance data to normalize distributions

  • Plotting NDUFB8 abundance against VDAC (mitochondrial mass marker) on 2D plots

  • Application of Bayesian classification to identify "like-control" versus "not-like-control" myofibers

  • Quantification of the proportion of deficient cells within each sample

The Bayesian approach substantially reduces misclassification compared to frequentist methods, as demonstrated in the confusion matrices below:

Frequentist Method (High Misclassification Rate):

NDUFB8Manual Classification
0 (Like-control)
Model 074
Model 1451

Bayesian Method (Low Misclassification Rate):

NDUFB8Manual Classification
0 (Like-control)
Model 0525
Model 10

This advanced analytical approach is particularly valuable when working with limited control samples, which is common in mouse studies .

What qPCR protocols are most effective for analyzing NDUFB8 expression in mouse models? [Basic]

While the search results don't specifically address NDUFB8 qPCR protocols in mice, we can adapt established protocols used for related NADH dehydrogenase subunits. Based on protocols for ND1, ND4, and ND5 , an effective qPCR approach would involve:

  • RNA extraction using standard tissue homogenization methods

  • cDNA synthesis with oligo(dT) and random hexamer primers

  • qPCR conditions: pre-denaturation at 95°C for 7 minutes (1 cycle), followed by 40 cycles of denaturation at 95°C for 10 seconds and annealing at 60°C for 20 seconds, with a final extension step at 95°C for 15 seconds and 60°C for 15 seconds

  • Use of GAPDH as an internal reference gene for normalization

  • Analysis using the 2^(-ΔΔCT) method to calculate relative expression

Researchers should design mouse-specific primers targeting the NDUFB8 gene, ensuring proper validation of primer efficiency and specificity before experimental application.

How do NDUFB8 variants contribute to mitochondrial dysfunction in mouse models of disease? [Advanced]

NDUFB8 variants can cause significant mitochondrial dysfunction, particularly deficiency of mitochondrial Complex I, which manifests as Leigh-like encephalomyopathy in human patients . In mouse models, these variants typically disrupt the assembly or stability of Complex I, leading to impaired oxidative phosphorylation and energy production. The pathophysiological mechanisms involve:

  • Decreased Complex I activity, reducing electron transfer efficiency

  • Increased reactive oxygen species (ROS) production due to electron leakage

  • Compromised ATP synthesis and cellular energy deficiency

  • Activation of mitochondrial quality control mechanisms and potentially mitophagy

  • Tissue-specific effects, with high-energy demanding tissues (brain, muscle, heart) most severely affected

Mouse models with NDUFB8 deficiency typically exhibit progressive neurodegenerative phenotypes, exercise intolerance, and lactic acidosis, mirroring human mitochondrial disorders .

What is the relationship between NDUFB8 expression and proliferation in cancer models? [Advanced]

While direct evidence for NDUFB8's role in cancer is limited in the provided search results, insights can be drawn from research on related NADH dehydrogenase subunits. Studies with ND1/4/5 have demonstrated that silencing these subunits inhibits proliferation of acute myeloid leukemia (AML) cells in nude mouse transplantation models . By extension, NDUFB8, as an important Complex I component, likely plays a similar role in cancer cell metabolism.

The mechanisms potentially include:

  • Alteration of cellular bioenergetics, shifting between oxidative phosphorylation and glycolysis

  • Modulation of mitochondrial ROS signaling, which affects proliferative pathways

  • Influence on apoptotic sensitivity through mitochondrial membrane potential regulation

  • Potential involvement in metabolic reprogramming characteristic of cancer cells

Researchers investigating NDUFB8 in cancer contexts should consider these mechanisms while designing experiments to elucidate its specific contribution to tumorigenesis or cancer progression.

What are the optimal transfection protocols for NDUFB8 overexpression in mouse cell lines? [Advanced]

Based on established protocols for related mitochondrial proteins, effective transfection for NDUFB8 overexpression in mouse cell lines can be achieved using lipid-based transfection methods . A recommended protocol includes:

  • Vector selection: Use a mammalian expression vector such as pCMV3 for optimal expression in mouse cells

  • Construct preparation: Generate pCMV3-NDUFB8 recombinant plasmid, with appropriate controls (empty pCMV3-untagged vector)

  • Transfection procedure:

    • Add 20 pmol of plasmid to 50 μl Opti-MEM serum-free medium

    • Add 1 μl Lipofectamine to 50 μl Opti-MEM

    • Mix and incubate for 20 minutes at room temperature

    • Add the mixture to cell suspension

    • Culture at 37°C with 5% CO₂

  • Validation: Verify expression after 48 hours using Western blotting with anti-NDUFB8 antibodies at 1:1000 dilution

This approach typically yields expression within 24-48 hours, with peak expression around 48-72 hours post-transfection.

How can researchers effectively analyze NDUFB8 interactome in mitochondrial complexes? [Advanced]

Analyzing the NDUFB8 interactome in mitochondrial complexes requires specialized approaches due to the protein's membrane localization and integration within Complex I. An effective methodological approach includes:

  • Mitochondrial isolation and membrane fraction preparation:

    • Use differential centrifugation to isolate intact mitochondria

    • Further fractionate to obtain inner membrane-enriched samples

    • Solubilize using mild detergents (digitonin or DDM) to preserve protein-protein interactions

  • Co-immunoprecipitation (Co-IP) with NDUFB8-specific antibodies:

    • Use recombinant antibodies for superior reproducibility

    • Employ crosslinking approaches to stabilize transient interactions

    • Include appropriate controls (IgG, reverse Co-IP)

  • Blue Native-PAGE (BN-PAGE) to maintain native complex integrity:

    • Separate intact Complex I and subcomplexes

    • Perform second-dimension SDS-PAGE for component analysis

    • Identify interaction partners via Western blotting or mass spectrometry

  • Proximity-based labeling approaches:

    • Generate NDUFB8 fusion constructs with BioID or APEX2

    • Express in mouse cell lines to label proximal proteins

    • Identify labeled proteins via streptavidin pulldown and mass spectrometry

  • Validation of key interactions:

    • Confirm with reciprocal Co-IP

    • Assess functional relevance through knockdown studies

    • Investigate co-localization using super-resolution microscopy

This multi-faceted approach enables comprehensive mapping of NDUFB8's interaction partners within the complex mitochondrial environment.

How should researchers interpret contradictory NDUFB8 expression patterns between protein and mRNA levels? [Advanced]

When researchers encounter contradictory patterns between NDUFB8 protein and mRNA expression levels, several methodological considerations should guide interpretation:

  • Post-transcriptional regulation:

    • NDUFB8, like many mitochondrial proteins, undergoes extensive post-transcriptional regulation

    • Assess microRNA targeting of NDUFB8 transcripts

    • Investigate RNA-binding proteins that may affect translation efficiency

  • Protein stability and turnover:

    • Examine ubiquitination and proteasomal degradation pathways

    • Consider mitochondrial proteases that may selectively target NDUFB8

    • Assess half-life differences between the transcript and protein

  • Methodological considerations:

    • Validate antibody specificity against recombinant standards

    • Ensure qPCR primers span exon-exon junctions to prevent genomic DNA amplification

    • Use multiple reference genes/proteins for normalization

  • Physiological context:

    • Tissue-specific translational regulation may occur

    • Stress conditions might differentially affect transcript and protein levels

    • Consider temporal dynamics (protein accumulation versus transient transcription)

  • Analytical approach:

    • Apply Bayesian statistical models that can account for biological variability

    • Use log-transformation of data to improve normality for statistical testing

    • Consider multivariate analysis incorporating other OXPHOS components

By systematically addressing these factors, researchers can resolve apparent contradictions and gain deeper insights into NDUFB8 regulation.

What statistical approaches are most appropriate for analyzing NDUFB8 abundance in heterogeneous tissue samples? [Advanced]

Analysis of NDUFB8 abundance in heterogeneous tissue samples presents unique challenges requiring sophisticated statistical approaches. Based on research in OXPHOS protein analysis, the following methodological framework is recommended:

This sophisticated analytical framework enables accurate quantification of NDUFB8 deficiency even in tissues with mixed cell populations or variable mitochondrial content.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.