Recombinant Mouse NADH-ubiquinone oxidoreductase chain 3 (Mtnd3)

Shipped with Ice Packs
In Stock

Description

Introduction to NADH-ubiquinone oxidoreductase chain 3 (Mtnd3)

NADH-ubiquinone oxidoreductase chain 3 (Mtnd3) is one of seven mitochondrially encoded subunits that form the core of Complex I (NADH dehydrogenase), the largest complex in the mitochondrial respiratory chain. In mice, the MT-ND3 gene is located in the mitochondrial genome, spanning approximately 345 base pairs and encoding a protein of around 115 amino acids . This protein is highly conserved across mammalian species, sharing approximately 69% sequence identity between mouse and human orthologs .

The Mtnd3 protein forms part of the hydrophobic core of Complex I's transmembrane domain, which anchors the enzyme complex within the inner mitochondrial membrane. Complex I catalyzes the transfer of electrons from NADH to ubiquinone, coupled with proton translocation across the inner mitochondrial membrane, thereby contributing to the proton gradient necessary for ATP synthesis . This process represents the first step in the mitochondrial respiratory chain, making Mtnd3 fundamental to cellular energy metabolism.

Structure and Properties of Mouse Mtnd3

Mouse Mtnd3 is a small, hydrophobic protein characterized by multiple transmembrane domains that integrate into the inner mitochondrial membrane. While the exact three-dimensional structure of mouse Mtnd3 has not been fully elucidated, its properties can be inferred from homologous proteins in related species.

Comparative Analysis of Mtnd3 Across Species

The conservation of MT-ND3 across species reflects its fundamental importance in mitochondrial function. The table below summarizes the sequence identity relationships between human MT-ND3 and its orthologs:

SpeciesSequence Identity to Human MT-ND3
Human100%
Mouse69%
Rat69%

Based on information from search result

The northern pygmy mouse (Baiomys taylori) MT-ND3 protein consists of 115 amino acids with a specific amino acid sequence that includes multiple hydrophobic regions forming transmembrane domains . The mouse (Mus musculus) Mtnd3 likely shares significant structural and functional characteristics with this related species.

Key Properties of Recombinant Mouse Mtnd3

PropertyCharacteristic
Gene SymbolMT-ND3
Protein LengthApproximately 115 amino acids
Molecular WeightApproximately 13 kDa
Cellular LocalizationMitochondrial inner membrane
FunctionComponent of Complex I, electron transport
Expression SystemTypically E. coli
Common Affinity TagsPolyhistidine (His)
Storage Conditions-20°C/-80°C in buffer with glycerol

Based on information synthesized from search results , , and

Production and Purification of Recombinant Mouse Mtnd3

The production of recombinant mouse Mtnd3 involves several technical challenges due to its hydrophobic nature and membrane protein characteristics. Nonetheless, established protocols for membrane protein expression have enabled successful production of recombinant Mtnd3 for research applications.

Expression Systems and Methods

Recombinant mouse Mtnd3 is typically expressed in bacterial systems, with Escherichia coli being the predominant host organism. Based on similar recombinant mitochondrial proteins, the MT-ND3 gene is cloned into an expression vector, often incorporating an N-terminal or C-terminal affinity tag (commonly polyhistidine) to facilitate purification . The expression construct is then transformed into an E. coli strain optimized for membrane protein expression.

Expression conditions must be carefully optimized to balance protein yield with proper folding. This often involves lower induction temperatures (16-25°C) and reduced inducer concentrations to slow protein synthesis and allow proper membrane integration.

Purification Strategies

Purification of recombinant mouse Mtnd3 typically follows a multi-step process:

  1. Cell lysis using detergents suitable for membrane protein extraction

  2. Immobilized metal affinity chromatography (IMAC) utilizing the His-tag

  3. Size exclusion chromatography for further purification

  4. Quality assessment via SDS-PAGE to confirm purity (typically >90%)

The purified protein is often formulated in a stabilizing buffer containing detergents or lipids to maintain the native structure of this membrane protein. Addition of glycerol (typically 30-50%) helps prevent protein aggregation and preserves activity during storage .

Functional Characterization of Recombinant Mouse Mtnd3

The functional characterization of recombinant mouse Mtnd3 primarily focuses on its role within Complex I and contribution to NADH-ubiquinone oxidoreductase activity.

Enzymatic Activity Assessment

The NADH-ubiquinone oxidoreductase activity can be measured spectrophotometrically by monitoring the oxidation of NADH at 340 nm (ε = 6.22 mM^-1 cm^-1). A typical assay protocol involves:

  1. Pre-incubation of the enzyme with various concentrations of ubiquinone

  2. Initiation of the reaction by adding NADH (typically 100 μM)

  3. Measurement of the decrease in absorbance at 340 nm

  4. Calculation of kinetic parameters (Km and Vmax) for ubiquinone by fitting to the Michaelis-Menten model

These assays provide valuable information about the functional integrity of recombinant Mtnd3 when reconstituted with other Complex I components.

Ubiquinone Binding and Electron Transfer

The interaction between Mtnd3 and ubiquinone is critical for the electron transfer function of Complex I. Studies with yeast NADH dehydrogenase have identified key amino acid residues involved in ubiquinone binding, with mutations affecting both Km values for ubiquinone and catalytic efficiency (Vmax) . Similar structure-function relationships likely exist in mouse Mtnd3, where specific residues contribute to ubiquinone binding and electron transfer.

Mutation TypeEffect on Ubiquinone Binding (Km)Effect on Catalytic Activity (Vmax)
ConservativeMinimal changeMinimal change
Size-altering1.7-3.3 fold increase in KmVariable effects
Charge-alteringSignificant increase in KmSignificant decrease

Based on analogous information from yeast NADH dehydrogenase

Applications in Research and Biotechnology

Recombinant mouse Mtnd3 serves as a valuable tool for multiple research applications, particularly in studies focused on mitochondrial function and dysfunction.

Immunological Applications

Recombinant Mtnd3 proteins can serve as antigens for antibody production or as control fragments in immunoassays. For example, recombinant human MT-ND3 control fragments are used for blocking experiments with corresponding antibodies . Similar applications can be developed for mouse Mtnd3, enabling specific detection of this protein in experimental systems.

Disease Modeling and Therapeutic Development

Mutations in MT-ND3 have been associated with several human mitochondrial disorders, including Mitochondrial encephalomyopathy, lactic acidosis, and stroke-like episodes (MELAS), Leigh's syndrome (LS), and Leber's hereditary optic neuropathy (LHON) . Recombinant mouse Mtnd3 provides a platform for:

  1. Modeling disease-associated mutations

  2. Screening potential therapeutic compounds

  3. Investigating the molecular pathogenesis of mitochondrial disorders

Clinical Relevance and Pathological Implications

The clinical significance of MT-ND3 extends beyond rare mitochondrial disorders to potential roles in more common diseases and conditions.

MT-ND3 Polymorphisms and Disease Susceptibility

Recent research has identified associations between MT-ND3 polymorphisms and various diseases. For example, polymorphisms rs28358278, rs2853826, and rs41467651 have been linked to increased susceptibility to gastric cancer development . The rs2853826 polymorphism has also been associated with increased reactive oxygen species (ROS) production in type 2 diabetes mellitus .

These findings suggest that MT-ND3 variants may contribute to disease pathogenesis through altered Complex I function, potentially leading to changes in:

  1. Electron transport efficiency

  2. ROS production

  3. Mitochondrial membrane potential

  4. ATP synthesis

Neurodegenerative Disease Connections

MT-ND3 mutations may be associated with Parkinson's disease, highlighting the potential role of mitochondrial dysfunction in neurodegenerative conditions . Recombinant mouse Mtnd3 provides a valuable tool for investigating these connections and identifying potential therapeutic targets.

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement when placing the order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which you can use as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Mtnd3; mt-Nd3; Nd3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Mtnd3
Target Protein Sequence
MNLYTVIFINILLSLTLILVAFWLPQMNLYSEKANPYECGFDPTSSARLPFSMKFFLVAI TFLLFDLEIALLLPLPWAIQTIKTSTMMIMAFILVTILSLGLAYEWTQKGLEWTE
Uniprot No.

Target Background

Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that catalyzes electron transfer from NADH through the respiratory chain, utilizing ubiquinone as an electron acceptor. This protein is essential for the catalytic activity of complex I.
Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MTND3 and what is its fundamental role in mitochondrial function?

MTND3 (mitochondrial NADH dehydrogenase subunit 3) is one of seven mitochondrial DNA-encoded subunits of Complex I (NADH:ubiquinone oxidoreductase), the largest complex of the mitochondrial respiratory chain. Complex I functions in the transfer of electrons from NADH to ubiquinone in the electron transport system (ETS). As a component of Complex I, MTND3 plays a crucial role in cellular energy production through oxidative phosphorylation .

The importance of MTND3 is underscored by the fact that mutations in this gene are associated with isolated Complex I deficiency, which can manifest as serious neurological conditions including Leigh syndrome and dystonia . The proper functioning of MTND3 is essential for maintaining mitochondrial integrity and cellular bioenergetics, highlighting its fundamental role in energy metabolism across different tissues.

How is MTND3 gene organized within the mitochondrial genome?

MTND3 is encoded by the mitochondrial DNA (mtDNA), which is distinct from the nuclear genome in several aspects, including its circular structure, maternal inheritance pattern, and higher mutation rate . The gene is located at position 10,059-10,404 in the human mitochondrial genome (NC_012920) .

Interestingly, MTND3 uses a recoded start codon rather than the conventional AUG start codon used by many genes . This non-canonical translation initiation is part of the unique genetic code used by mitochondria. When analyzing mitoribosome coverage at the 5' terminus of various mitochondrial genes, research has shown that MTND3's start codon has distinct characteristics compared to other mitochondrial genes, which has implications for its translation efficiency and regulation .

What methodologies are available for MTND3 gene detection and sequencing?

Several methodologies can be employed for detecting and sequencing the MTND3 gene:

  • PCR Amplification and Sanger Sequencing: This approach involves designing specific primers targeting the MTND3 region. For example, primers such as forward 5′-CCACAACTCAACGGCTACAT-3′ and reverse 5′-TGGGTGTTGAGGGTTATGAG-3′ have been successfully used to amplify a 491 bp product containing the MTND3 gene .

  • Next-Generation Sequencing (NGS): For higher throughput analysis, NGS technologies can sequence the entire mitochondrial genome, allowing for the detection of variants in MTND3 along with other mtDNA genes.

  • Restriction Fragment Length Polymorphism (RFLP): This technique can be used to identify specific known mutations or polymorphisms in MTND3.

  • Mitoribosomal Profiling: This advanced technique maps the position of mitoribosomes on mitochondrial transcripts, providing insights into translation dynamics of MTND3 and other mitochondrial genes .

When analyzing sequence data, it's essential to use the appropriate reference sequence (e.g., human MT:10398, GenBank accession number: NC_012920) to accurately identify SNPs and other genetic variants .

How do mutations in MTND3 affect Complex I assembly and function?

Mutations in MTND3 can significantly impact Complex I assembly and function through multiple mechanisms:

  • Structural Destabilization: Mutations in highly conserved domains of MTND3, such as the 10197G>A mutation (resulting in an A47T amino acid change), can alter the hydrophobicity profile of the protein. This change from a hydrophobic alanine to a hydrophilic threonine in a conserved domain can destabilize the structure of Complex I .

  • Assembly Defects: Some MTND3 mutations may interfere with the proper assembly of Complex I, which contains at least 45 subunits. Improper assembly can result in reduced Complex I levels or the accumulation of subcomplexes.

  • Functional Impairment: Even when Complex I assembles correctly, mutations in MTND3 can directly impair its enzymatic function. This is evidenced by isolated Complex I deficiency observed in patients with MTND3 mutations, particularly affecting NADH:ubiquinone oxidoreductase activity .

  • Heteroplasmy Effects: The severity of the functional defect often correlates with the degree of heteroplasmy (the proportion of mutant mtDNA) in affected tissues. Higher percentages of mutant mtDNA in muscle tissue, for instance, correlate with more severe biochemical defects .

Research methodologies to study these effects include cybrid experiments (transferring mutant mtDNAs to ρ° lymphoblastoid cells), enzymatic activity assays, blue native polyacrylamide gel electrophoresis for complex assembly analysis, and high-resolution respirometry to assess mitochondrial respiration capacity .

What are the established protocols for measuring Complex I activity in the context of MTND3 research?

Established protocols for measuring Complex I activity in MTND3 research include:

  • Spectrophotometric NADH Oxidation Assay:

    • Principle: Measurement of NADH consumption rate in the presence of ubiquinone Q1 as an electron acceptor

    • Procedure: Isolated mitochondria are provided with NADH (electron donor) and ubiquinone Q1 (electron acceptor)

    • Detection: NADH consumption is measured photometrically

    • Validation: Rotenone (a specific Complex I inhibitor) is used to confirm the specificity of the measurement

    • Quantification: Activity is calculated as the rotenone-sensitive rate of NADH oxidation

  • High-Resolution Respirometry:

    • This technique measures oxygen consumption in intact mitochondria using substrates that generate NADH (such as malate and pyruvate)

    • Allows for the assessment of integrated respiratory function in the context of the entire electron transport system

    • Can detect subtle changes in respiratory capacity related to MTND3 mutations or manipulations

  • In-Gel Activity Assays:

    • Complex I is separated by blue native polyacrylamide gel electrophoresis

    • Activity is visualized by incubating the gel with NADH and nitrotetrazolium blue, resulting in purple bands where Complex I is active

For accurate results, it's crucial to maintain mitochondrial integrity during isolation and to include appropriate controls. For example, when studying the effects of a recombinant protein on Complex I activity, an inactive mutant version of the protein can serve as a control, as demonstrated in studies using NS3proS135A as a control for NS3pro .

How does heteroplasmy of MTND3 mutations influence phenotypic expression?

Heteroplasmy—the presence of both wild-type and mutant mtDNA in varying proportions—significantly influences the phenotypic expression of MTND3 mutations through several mechanisms:

  • Tissue-Specific Threshold Effects:

    • Different tissues have varying thresholds for manifesting respiratory chain defects

    • In cases of MTND3 mutations like 10197G>A, variable degrees of heteroplasmy are found across tissues

    • High percentages of mutant mtDNA in muscle correlate with more severe biochemical and clinical manifestations

  • Mutation Load Progression:

    • The proportion of mutant mtDNA can change over time due to mitotic segregation

    • This can lead to progressive worsening of symptoms as certain tissues accumulate higher loads of mutant mtDNA

  • Nuclear Genetic Modifiers:

    • Nuclear modifier genes play a role in the phenotypic expression and severity of MTND3 mutations

    • The same mtDNA mutation can result in different clinical presentations depending on the nuclear genetic background

  • Variable Clinical Presentations:

    • The 10197G>A mutation in MTND3 has been associated with both Leigh syndrome and dystonia

    • The specific presentation may depend on the heteroplasmy level in different tissues, particularly in the central nervous system

Research approaches to study heteroplasmy effects include:

  • Quantitative analysis of mutation load across different tissues

  • Cybrid cell models with controlled levels of heteroplasmy

  • Correlation of heteroplasmy levels with biochemical parameters (e.g., Complex I activity) and clinical features

  • Longitudinal studies tracking changes in heteroplasmy and clinical progression

What are the differences between human and mouse MTND3 in terms of structure and function?

Comparing human and mouse MTND3 reveals important similarities and differences relevant to research applications:

FeatureHuman MTND3Mouse MTND3Research Implications
Sequence homologyReference~85% similarityMouse models can serve as reasonable but not perfect analogues for human mitochondrial disease
Protein length115 amino acids115 amino acidsConserved size suggests similar structural roles
Conserved domainsHighly conserved A47 residueConserved at equivalent positionKey functional residues are maintained across species
Start codonNon-canonicalNon-canonicalBoth use recoded start codons, reflecting evolutionary conservation of mitochondrial genetic code
Response to inhibitorsSensitive to rotenoneSensitive to rotenoneSimilar pharmacological profiles allow for comparable inhibitor studies
Complex I integration1 of 7 mtDNA-encoded subunits1 of 7 mtDNA-encoded subunitsStructural role within Complex I is maintained
Mutation hotspots10197G>A (A47T) pathogenicEquivalent positions may existPotential for creating mouse models of human pathogenic mutations

When using recombinant mouse MTND3 in research, these differences and similarities must be considered, especially when extrapolating findings to human disease contexts. The high conservation of key functional domains suggests that mouse models can provide valuable insights into MTND3 function, while species-specific differences may explain some limitations in disease modeling .

How can mitoribosomal profiling be used to study MTND3 translation?

Mitoribosomal profiling is an advanced technique that provides insights into translation dynamics of mitochondrial genes, including MTND3:

  • Methodology:

    • Isolation of mitochondrial ribosomes (mitoribosomes) bound to mRNAs

    • RNase digestion to generate ribosome-protected fragments (footprints)

    • Next-generation sequencing of these footprints

    • Bioinformatic analysis to map the position and abundance of mitoribosomes on transcripts

  • MTND3-Specific Applications:

    • Analysis of translation initiation at the non-canonical start codon of MTND3

    • Identification of ribosome pausing sites within the MTND3 coding sequence

    • Comparison of translational efficiency between wild-type and mutant MTND3 sequences

    • Study of codon usage and its impact on translation rates

  • Analytical Approaches:

    • Mapping footprints to nucleotide positions in the mtDNA reference sequence

    • Calculating fractional footprint profiles at each codon

    • Statistical comparison using multiple one-sample, two-tailed t-tests

    • Correction for multiple testing using FDR (False Discovery Rate) with q < 0.05 considered significant

  • Visualization and Interpretation:

    • Representation of results with the x-axis showing nucleotide position in reference mtDNA

    • Analysis of footprints covering the 5' termini to study translation initiation

    • Comparison of MTND3 mitoribosome coverage patterns with other mitochondrial genes

    • Identification of motifs associated with mitoribosome pausing

This technique has revealed that MTND3 has distinctive translation initiation characteristics, with only a small percentage of protected sequences covering its recoded start codon (2.8% for MTND2 with AUU start codon, potentially similar for MTND3) . These findings provide critical insights into the regulation of MTND3 expression and the specialized mechanisms of mitochondrial translation.

What disease associations have been established for MTND3 mutations?

Several disease associations have been established for MTND3 mutations:

  • Leigh Syndrome (LS):

    • The 10197G>A mutation in MTND3 has been identified in multiple unrelated families with LS

    • LS is characterized by progressive neurodegeneration with bilateral lesions in the basal ganglia and brainstem

    • The mutation causes an A47T amino acid change in a highly conserved domain of the ND3 subunit

  • Dystonia:

    • The same 10197G>A mutation has also been linked to dystonia without the full LS phenotype

    • This suggests a spectrum of clinical presentations depending on heteroplasmy and other factors

  • Mitochondrial Complex I Deficiency:

    • MTND3 mutations are associated with isolated Complex I deficiency

    • This biochemical phenotype underlies various clinical manifestations including LS and dystonia

  • Cancer Susceptibility:

    • Polymorphisms in MTND3 have been studied in relation to gastric cancer risk

    • Previous studies have shown significant correlations of polymorphisms in MTND3 with the risk of Parkinson's disease, type 2 diabetes mellitus, and breast and esophageal cancers

  • Type 2 Diabetes Mellitus:

    • The single nucleotide polymorphism at locus rs2853826 in MTND3 has been associated with increased ROS production in type 2 diabetes mellitus

For researchers studying these disease associations, it's important to note that the pathogenicity of MTND3 mutations is supported by:

  • Recurrence of the same mutation (e.g., 10197G>A) in unrelated families with similar phenotypes

  • Segregation of the mutation with disease in maternal lineages

  • Higher mutation load in affected tissues

  • Conservation of affected amino acids across species

  • Functional evidence from biochemical studies and cybrid experiments

What methodological approaches are used to validate the pathogenicity of novel MTND3 mutations?

Validating the pathogenicity of novel MTND3 mutations requires a multifaceted approach:

  • Clinical and Genetic Criteria:

    • Family segregation analysis following maternal inheritance patterns

    • Absence or low frequency in population databases

    • Assessment of heteroplasmy across multiple tissues from affected individuals

    • Conservation analysis of the affected amino acid residue across species

  • Biochemical Validation:

    • Measurement of Complex I activity in patient samples (typically muscle biopsies)

    • Assessment of isolated Complex I deficiency using spectrophotometric assays

    • Exclusion of defects in other respiratory chain complexes (II-V)

  • Cybrid Cell Studies:

    • Transfer of mutant mtDNAs to ρ° lymphoblastoid cells (cells depleted of endogenous mtDNA)

    • Demonstration that the biochemical defect transfers with the mutant mtDNA

    • Establishment of threshold levels of mutation load required for biochemical expression

  • Structural and Functional Predictions:

    • Analysis of the predicted impact of the mutation on protein structure

    • Assessment of changes in hydrophobicity, charge, or other physicochemical properties

    • Evaluation of the location of the mutation within known functional domains

  • Recombinant Protein Studies:

    • Expression of wild-type and mutant MTND3 in heterologous systems

    • Integration into Complex I and assessment of assembly and function

    • Comparison with known pathogenic mutations (e.g., 10197G>A causing A47T)

A comprehensive approach combining these methods provides robust evidence for pathogenicity. For example, the 10197G>A mutation was established as pathogenic based on:

  • Its identification in three independent families with LS or dystonia

  • The highly conserved nature of the affected alanine residue (A47)

  • The significant physicochemical change from hydrophobic alanine to hydrophilic threonine

  • The transfer of the biochemical defect in cybrid experiments

  • The isolated Complex I deficiency observed in patient samples

How can recombinant MTND3 be effectively produced for functional studies?

Producing recombinant MTND3 presents unique challenges due to its hydrophobic nature and mitochondrial origin. Here's a methodological approach:

  • Expression System Selection:

    • Bacterial systems (E. coli): Suitable for producing MTND3 fragments or domains

    • Yeast systems (S. cerevisiae): Better for full-length MTND3 due to more sophisticated membrane protein machinery

    • Mammalian cell systems: Optimal for functional studies requiring proper folding and post-translational modifications

  • Construct Design Considerations:

    • Codon optimization for the chosen expression system

    • Addition of purification tags (His, FLAG, etc.) at N- or C-terminus

    • Inclusion of solubility-enhancing fusion partners (MBP, SUMO, etc.)

    • Engineering of membrane protein leader sequences for proper targeting

  • Solubilization and Purification Strategy:

    • Use of mild detergents (DDM, LMNG) to extract membrane proteins

    • Two-step purification using affinity chromatography followed by size exclusion

    • Quality control through Western blotting and mass spectrometry

  • Functional Reconstitution:

    • Incorporation into liposomes or nanodiscs for functional studies

    • Co-expression with partner proteins from Complex I

    • Validation of proper folding through circular dichroism or infrared spectroscopy

  • Alternative Approaches:

    • Cell-free protein synthesis systems optimized for membrane proteins

    • Synthetic peptide approaches for specific domains

    • Split protein complementation for assembly studies

When designing functional assays with recombinant MTND3, it's essential to include appropriate controls, such as known pathogenic mutations (e.g., equivalent to human A47T) and catalytically inactive versions. The successful production of functional recombinant MTND3 enables diverse applications, from structural studies to drug screening and interaction analysis .

What are the most effective protocols for studying MTND3 incorporation into Complex I?

Studying MTND3 incorporation into Complex I requires specialized techniques that address the complexities of mitochondrial complex assembly:

  • Blue Native Polyacrylamide Gel Electrophoresis (BN-PAGE):

    • Separation of intact respiratory complexes under native conditions

    • Immunodetection of MTND3 and other Complex I subunits

    • Analysis of assembly intermediates containing MTND3

    • Second-dimension SDS-PAGE to resolve individual subunits within complexes

  • Pulse-Chase Labeling:

    • Metabolic labeling of newly synthesized mitochondrial proteins with radioactive amino acids

    • Immunoprecipitation with MTND3-specific antibodies

    • Temporal analysis of MTND3 incorporation into Complex I assembly intermediates

    • Assessment of assembly kinetics in wild-type versus mutant conditions

  • Proximity Labeling Techniques:

    • Expression of MTND3 fused to enzymes like BioID or APEX2

    • Identification of proteins in close proximity during assembly

    • Mass spectrometry analysis of biotinylated proteins

    • Mapping of interaction partners during different assembly stages

  • Fluorescence Microscopy Approaches:

    • Creation of fluorescently tagged MTND3 variants

    • Live-cell imaging of incorporation into mitochondrial complexes

    • Förster resonance energy transfer (FRET) to study interactions with other subunits

    • Super-resolution microscopy for detailed localization studies

  • Biochemical Complementation:

    • Introduction of recombinant MTND3 into isolated mitochondria with depleted or mutated endogenous MTND3

    • Assessment of Complex I assembly and activity restoration

    • Analysis of competition between wild-type and mutant variants

    • Titration experiments to determine threshold effects

Each of these approaches provides complementary information about MTND3 incorporation, with the choice of method depending on the specific research question. For comprehensive studies, a combination of these techniques offers the most complete picture of MTND3's role in Complex I assembly and function .

How can heteroplasmy of MTND3 mutations be accurately quantified across different tissues?

Accurate quantification of MTND3 mutation heteroplasmy across tissues requires sensitive and precise methodologies:

  • Restriction Fragment Length Polymorphism (RFLP):

    • Design of primers flanking the mutation site

    • PCR amplification of the target region

    • Digestion with restriction enzymes that differentially cut wild-type and mutant sequences

    • Quantification of band intensities to determine relative proportions

    • Sensitivity: Can detect heteroplasmy levels of approximately 5-10%

  • Pyrosequencing:

    • Design of sequencing primers adjacent to the mutation site

    • Generation of a pyrogram showing peak heights proportional to nucleotide incorporation

    • Calculation of mutation load based on relative peak heights

    • Sensitivity: Can reliably detect heteroplasmy levels of 1-5%

  • Digital Droplet PCR (ddPCR):

    • Partitioning of PCR reaction into thousands of droplets

    • Amplification with probes specific for wild-type and mutant sequences

    • Counting of positive droplets for each sequence variant

    • Statistical analysis for precise heteroplasmy calculation

    • Sensitivity: Can detect heteroplasmy levels as low as 0.1%

  • Next-Generation Sequencing (NGS):

    • Deep sequencing of PCR-amplified MTND3 regions

    • Bioinformatic analysis of read counts for wild-type and mutant sequences

    • Correction for sequencing errors and PCR bias

    • Sensitivity: Can detect heteroplasmy levels of 0.5-1% with sufficient depth

  • Single-Cell Analysis:

    • Isolation of individual cells from different tissues

    • Whole mitochondrial genome amplification

    • Sequencing to determine heteroplasmy at the cellular level

    • Analysis of tissue-specific heteroplasmy distribution patterns

For accurate comparison across tissues, it's essential to:

  • Process all samples using identical protocols

  • Include appropriate controls with known heteroplasmy levels

  • Perform technical replicates to assess measurement variability

  • Consider the mitochondrial DNA copy number in different tissues

When studying disease-causing mutations like 10197G>A in MTND3, these approaches have revealed variable degrees of heteroplasmy across tissues, with particularly high percentages of mutant mtDNA often observed in muscle tissue of affected individuals .

What emerging technologies are advancing our understanding of MTND3 function and pathology?

Several cutting-edge technologies are transforming MTND3 research:

  • Cryo-Electron Microscopy (Cryo-EM):

    • High-resolution structural determination of Complex I

    • Visualization of MTND3's position and interactions within the complex

    • Structural comparison between wild-type and mutant forms

    • Insights into conformational changes during electron transport

  • CRISPR-Based Mitochondrial Genome Editing:

    • Recently developed DddA-derived cytosine base editors (DdCBEs)

    • Precise introduction of MTND3 mutations in cellular and animal models

    • Creation of heteroplasmy models with controlled mutation loads

    • Assessment of mutation-specific effects on mitochondrial function

  • Single-Cell Multi-Omics:

    • Integrated analysis of mtDNA variants, transcriptome, and proteome at single-cell resolution

    • Correlation of MTND3 heteroplasmy with gene expression patterns

    • Identification of compensatory mechanisms in cells with MTND3 mutations

    • Mapping of tissue-specific responses to MTND3 dysfunction

  • Live-Cell Metabolic Imaging:

    • Genetically encoded sensors for NADH/NAD+ ratios

    • Real-time visualization of Complex I activity in living cells

    • Spatiotemporal analysis of metabolic changes following MTND3 manipulation

    • Correlation of metabolic dynamics with cellular phenotypes

  • Organoid and iPSC-Based Disease Modeling:

    • Patient-derived induced pluripotent stem cells carrying MTND3 mutations

    • Differentiation into affected cell types (neurons, muscle cells)

    • Three-dimensional organoid cultures recapitulating tissue-specific pathology

    • High-throughput drug screening in disease-relevant cellular contexts

These technologies are enabling researchers to address previously unanswerable questions about MTND3 function and pathology, potentially leading to novel therapeutic approaches for mitochondrial diseases involving Complex I deficiency .

What are the current challenges in developing therapeutic approaches for MTND3-related disorders?

Developing therapeutic approaches for MTND3-related disorders faces several significant challenges:

  • Heteroplasmy Manipulation:

    • Challenge: Selective elimination of mutant mtDNA while preserving wild-type copies

    • Current approaches: Mitochondrially-targeted nucleases, TALENs, and zinc-finger nucleases

    • Limitations: Potential off-target effects, incomplete elimination, and delivery issues

    • Research needs: Development of more specific targeting mechanisms for MTND3 mutations

  • Mitochondrial Drug Delivery:

    • Challenge: Efficient targeting of therapeutic agents to mitochondria across multiple membranes

    • Current approaches: Lipophilic cations, mitochondrial targeting sequences, and nanoparticle formulations

    • Limitations: Limited tissue distribution and potential toxicity

    • Research needs: Tissue-specific delivery systems, particularly for crossing the blood-brain barrier

  • Functional Complementation:

    • Challenge: Providing functional replacement for defective MTND3

    • Current approaches: Allotopic expression (nuclear encoding of mitochondrial genes)

    • Limitations: Import and assembly difficulties, proper integration into Complex I

    • Research needs: Improved protein delivery systems or RNA therapeutics

  • Metabolic Bypass Strategies:

    • Challenge: Compensating for Complex I dysfunction without directly targeting MTND3

    • Current approaches: Alternative electron carriers (e.g., idebenone), metabolic substrate modulation

    • Limitations: Incomplete rescue of ATP production, tissue-specific efficacy

    • Research needs: Development of more efficient bypass mechanisms specific to Complex I deficiency

  • Precision Medicine Implementation:

    • Challenge: Accounting for heteroplasmy levels, tissue specificity, and nuclear genetic modifiers

    • Current approaches: Patient-derived cellular models for drug screening

    • Limitations: Variable response based on individual genetic backgrounds

    • Research needs: Biomarkers for therapeutic response prediction and monitoring

The complexity of mitochondrial genetics, with its unique features such as heteroplasmy and threshold effects, makes MTND3-related disorders particularly challenging therapeutic targets. Current research is exploring multiple complementary approaches, with combination therapies likely offering the most promising path forward for addressing both the primary defect and downstream consequences of MTND3 dysfunction .

What controls are essential when studying recombinant MTND3 in experimental systems?

When studying recombinant MTND3, implementing rigorous controls is critical for generating reliable and interpretable data:

  • Expression System Controls:

    • Empty vector control: Accounts for effects of the expression system itself

    • Irrelevant protein control: Expression of an unrelated protein of similar size

    • Wild-type MTND3: Essential baseline for comparing mutant variants

    • Tagged-only control: When using fusion proteins, controls for tag effects

  • Mutation-Specific Controls:

    • Known pathogenic mutation (e.g., equivalent to human A47T): Positive control for dysfunction

    • Conservative mutation: Substitution with similar amino acid as negative control

    • Catalytically inactive variant: For distinguishing between structural and functional effects

    • Heteroplasmy mimics: Controlled mixtures of wild-type and mutant proteins

  • Assay-Specific Controls:

    • For Complex I activity assays:

      • Rotenone inhibition: Confirms specificity for Complex I activity

      • Intact vs. disrupted mitochondria: Distinguishes direct vs. indirect effects

      • Temperature controls: Accounts for temperature-dependent enzyme kinetics

      • Substrate titration: Ensures operation in appropriate kinetic range

  • System Integrity Controls:

    • Membrane potential measurement: Ensures mitochondrial membranes remain intact

    • Cytochrome c test: Detects outer membrane damage

    • Leak respiration assessment: Evaluates inner membrane integrity

    • Protein degradation monitoring: Verifies stability of recombinant protein

  • Specificity Controls:

    • Effects on other respiratory complexes (II-V): Confirms selectivity for Complex I

    • Rescue experiments: Restoration of function through complementation

    • Dose-response relationships: Demonstrates specificity and excludes non-specific toxicity

An excellent example of control implementation is seen in studies of NS3 protein effects on Complex I, where both NS3pro and its catalytically inactive mutant (NS3proS135A) were tested in parallel. While NS3pro inhibited Complex I activity, NS3proS135A had no significant effect, demonstrating the dependence of the inhibition on protease activity .

How can researchers optimize the isolation of mitochondria for MTND3 functional studies?

Optimizing mitochondrial isolation for MTND3 functional studies requires careful attention to preserve both structural integrity and enzymatic activity:

  • Tissue/Cell Selection and Preparation:

    • Select tissues with high mitochondrial content (liver, heart, muscle) for maximal yield

    • Process tissues immediately after collection to minimize degradation

    • Maintain samples at 4°C throughout to preserve enzymatic activity

    • Use gentle mechanical disruption (e.g., Dounce homogenizer) to protect mitochondrial membranes

  • Isolation Buffer Optimization:

    • Standard components: 225 mM mannitol, 75 mM sucrose, 10 mM MOPS, pH 7.2

    • Critical additives:

      • EGTA (1 mM): Chelates calcium to prevent mitochondrial permeability transition

      • BSA (0.5%): Scavenges fatty acids and preserves membrane integrity

      • Protease inhibitors: Prevents degradation of mitochondrial proteins including MTND3

      • Phosphatase inhibitors: Maintains native phosphorylation state of proteins

  • Purification Method Selection:

    • Differential centrifugation: Simple but yields mixed mitochondrial populations

    • Density gradient centrifugation: Higher purity but lower yield

    • Magnetic immunocapture: Highest specificity but more expensive

    • Free-flow electrophoresis: Separates mitochondrial subpopulations

  • Quality Control Assessments:

    • Respiratory control ratio (RCR): Measures coupling of respiration to ATP synthesis

    • Citrate synthase activity: Normalizes for mitochondrial content

    • Cytochrome c test: Assesses outer membrane integrity

    • Electron microscopy: Visualizes structural integrity of isolated mitochondria

  • Storage Considerations:

    • Preferably use freshly isolated mitochondria

    • If storage is necessary, snap-freeze in liquid nitrogen in small aliquots

    • Include cryoprotectants (10% glycerol) in storage buffer

    • Validate activity after freezing compared to fresh preparations

For specific Complex I activity measurements, additional considerations include:

  • Ensuring substrate accessibility by preparing submitochondrial particles when necessary

  • Maintaining temperature control during isolation (4°C) and assays (25-30°C)

  • Standardizing protein concentration across experiments (typically 0.1-0.5 mg/ml)

  • Including specific inhibitors (rotenone) to distinguish Complex I-specific activity

The protocol used in high-resolution respirometry studies of Complex I provides an excellent example of optimized mitochondrial isolation that maintains functional integrity suitable for MTND3 research .

What bioinformatic approaches are most useful for analyzing MTND3 sequence variants?

Comprehensive analysis of MTND3 sequence variants requires specialized bioinformatic approaches tailored to mitochondrial genetics:

  • Variant Identification and Annotation:

    • Pipeline components:

      • Quality filtering of sequencing data with higher stringency for low-frequency heteroplasmy

      • Alignment to complete mitochondrial reference genome (e.g., NC_012920)

      • Variant calling with heteroplasmy-aware algorithms

      • Annotation with mitochondrial-specific databases (MITOMAP, HmtDB)

    • Critical parameters:

      • Coverage depth: Minimum 1000x for reliable heteroplasmy detection

      • Base quality score: Typically Phred ≥30

      • Strand bias filtering: Eliminate variants present predominantly on one strand

  • Conservation and Functional Prediction:

    • Multiple sequence alignment across species using MUSCLE or MAFFT

    • Conservation scoring using PhyloP or PhastCons specifically calibrated for mtDNA

    • Mitochondrial-specific prediction tools:

      • MitImpact: Predicts pathogenicity of variants in mitochondrial proteins

      • MToolBox: Integrated workflow for mtDNA variant analysis

      • APOGEE: Pathogenicity prediction for mitochondrial variants

  • Structural Impact Analysis:

    • Mapping variants to available Complex I structures (PDB IDs: 5LDW, 6RFR)

    • Molecular dynamics simulations to assess stability changes

    • Energy minimization calculations to predict structural perturbations

    • Analysis of effects on protein-protein interfaces within Complex I

  • Population Genetics and Haplogroup Analysis:

    • Haplogroup assignment using HaploGrep or similar tools

    • Background correction accounting for mitochondrial haplogroups

    • Assessment of variant frequency in population databases:

      • MitoMap: Mitochondrial variation database

      • 1000 Genomes Project mitochondrial data

      • Particular attention to tissue-specific somatic variation databases

  • Heteroplasmy Quantification and Visualization:

    • Statistical methods for accurate heteroplasmy quantification:

      • Beta-binomial distribution modeling to account for sequencing errors

      • Bayesian approaches for confidence interval estimation

    • Visualization approaches:

      • Circos plots for whole mitochondrial genome perspective

      • Lollipop plots for variant distribution along MTND3

      • Heat maps for cross-tissue heteroplasmy comparison

These approaches have been successfully applied to analyze variants such as the 10197G>A mutation in MTND3, establishing its pathogenicity based on conservation analysis, structural predictions, and population frequency .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.