Recombinant Mouse NADPH oxidase 1 (Nox1)

Shipped with Ice Packs
In Stock

Description

Functional Mechanisms

Nox1-derived ROS generation is tightly regulated by subunit interactions and redox-sensitive pathways:

  • Activation: Thrombin, platelet-derived growth factor (PDGF), or angiotensin II trigger phosphorylation of p47phox, enabling its binding to NoxA1 and membrane translocation .

  • Redox partners: Protein disulfide isomerase (PDI) facilitates disulfide bond formation between p47phox cysteines (e.g., Cys196-Cys378), enabling Nox1 complex assembly .

  • Downstream signaling: ROS modulate calcium influx, kinase activation (e.g., JAK2, Akt, p38 MAPK), and cytoskeletal remodeling .

Applications in Disease Models

  • Atherosclerosis:

    • NoxA1 overexpression in ApoE⁻/⁻ mice accelerates atherosclerotic lesion formation .

    • PDI-Nox1 interaction correlates with human carotid plaque progression .

  • Cancer:

    • Nox1 promotes colon cancer cell migration via Rac1 activation .

  • Ischemic Stroke:

    • Nox1 knockdown reduces neuronal death and enhances neurogenesis post-stroke .

Mechanistic Insights

  • ROS-dependent pathways:

    • Nox1-derived ROS activate SSH1L phosphatase, stabilizing cofilin for actin polymerization .

    • PP2A inactivation in Nox1-deficient cells disrupts front-rear polarity during migration .

  • Subunit cross-talk:

    • PDI oxidizes p47phox at Cys196, enabling Nox1-p22phox binding .

Challenges and Future Directions

  • Species-specific differences: Human vs. mouse Nox1 systems show divergent PKC dependency .

  • Therapeutic targeting: Small-molecule inhibitors (e.g., GKT771) show promise in blocking Nox1-p47phox interactions .

  • Unresolved questions:

    • Temporal regulation of Nox1-ROS bursts in vivo.

    • Role of Nox1 in non-vascular tissues (e.g., intestinal epithelia) .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order remarks. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Nox1; NADPH oxidase 1; NOX-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-591
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MAGELRGSRGPLQRIQIAPREAPNLHLTMGNWLVNHWLSVLFLVSWLGLNIFLFVYAFLN YEKSDKYYYTREILGTALALARASALCLNFNSMMILIPVCRNLLSFLRGTCSFCNRTLRK PLDHNLTFHKLVAYMICIFTVIHIIAHLFNFERYRRSQQAMDGSLASVLSSLSHPEKEDS WLNPIQSPNMTVMYAAFTSIAGLTGVIATVALVLMVTSAMEFIRRNYFELFWYTHHLFIV YIICLGIHGLGGIVRGQTEESLGESHPHNCSHSFHEWDDHKGSCRHPHFAGHPPESWKWI LAPIAFYIFERILRFYRSQQKVVITKVVMHPSNVLELQMRKRGFSMEVGQYIFVNCPSIS FLEWHPFTLTSAPEEEFFSVHIRAAGDWTRNLIRTFEQQHSPMPRIEVDGPFGTVSEDVF QYEVAVLVGAGIGVTPFASILKSIWYKFQRADNKLKTQKIYFYWICRETGAFAWFNNLLN SLEQEMEELGKMDFLNYRLFLTGWDSNIAGHAALNFDRATDILTGLKQKTSFGRPMWDNE FSRIATAHPKSAVGVFLCGPRTLAKSLRKRCQRYSSLDPRKVQFYFNKETF
Uniprot No.

Target Background

Function
Pyridine nucleotide-dependent oxidoreductase that generates superoxide and may conduct H(+) ions as part of its electron transport mechanism.
Gene References Into Functions
  1. These data highlight the role of NOX1-produced reactive oxygen species in maintaining gut microbiota homeostasis. PMID: 29210363
  2. Its pathway may contribute to reactive oxygen species generation in the early stages of Alzheimer's disease, potentially exacerbating the pathological phenotype. PMID: 29602494
  3. NADPH oxidase-mediated redox signaling plays a crucial role in the detrimental effects of C-reactive protein on pancreatic insulin secretion. PMID: 28778482
  4. These findings demonstrate that altered zinc distribution, leading to mitochondrial zinc accumulation, increases mitochondrial ROS production, triggering NF-kappaB activation. This, in turn, upregulates Nox1 expression, inducing senescence in vascular smooth muscle cells. PMID: 28363602
  5. Our data identify EBP50 as a previously unknown regulator of Nox1. EBP50 promotes Nox1 activity by binding p47(phox). This interaction is essential for agonist-induced smooth muscle ROS, hypertrophy, and vasoconstriction, with implications for ROS-mediated physiological and pathophysiological processes. PMID: 27540115
  6. We examined NOX expression patterns in spinal cords of patients and mouse models of ALS and analyzed the impact of genetic deletion of the NOX1 and 2 isoforms as well as pharmacological NOX inhibition in the SOD1(G93A) ALS mouse model. In contrast to previous studies, survival of SOD1(G93A) mice was not affected by breeding with constitutive NOX1 and NOX2 deficient mice. PMID: 27212019
  7. NOX-derived superoxide intensifies diabetogenic antiviral macrophage responses and offers protection against virus-induced diabetes. PMID: 29158420
  8. Using Ang II infused hph-1 mice, we investigated the roles of NOX isoforms in the development of AAA. We generated double mutants of hph-1-NOX1, hph-1-NOX2, hph-1-p47phox, and hph-1-NOX4. PMID: 27912196
  9. C-kit-positive hematopoietic stem/progenitor cells exhibited significantly higher levels of Nox1 and catalase but lower levels of lactoperoxidase compared to matured mononuclear cells. PMID: 25451257
  10. Nox1 deletion reduces oxidant load and restores microvascular health in obese mice. PMID: 28684629
  11. Data suggest that ROS production during primitive endoderm differentiation partly depends on increased NOX1 and NOX4 levels, controlled by GATA6. Additionally, these results indicate that the combined activity of multiple NOX proteins is crucial for the differentiation of F9 cells to primitive endoderm. PMID: 28152080
  12. Gp91phox NADPH oxidase modulates litter size by upregulating mucin1 expression in the uterus of mice. PMID: 28301257
  13. 5-HT1B receptor-dependent cellular Src-related kinase-Nox1-pathways contribute to vascular remodeling in pulmonary arterial hypertension. PMID: 28473438
  14. NOX4- and NOX1-derived ROS contribute to atherosclerosis in the aortic sinus of diabetic ApoE knockout mice. PMID: 27190136
  15. Data indicate that pan-NOX-inhibitor APX-115 treatment decreased NADPH oxidase (Nox) Nox1, Nox2, and Nox4 protein expression in the kidney. PMID: 28165467
  16. NOX1 is selectively important for GPCR-dependent intracellular ROS generation but dispensable for GPVI-ITAM-dependent ROS generation in blood platelets. PMID: 26988594
  17. Plasmid-driven elevation of NOX-1 resulted in elevated ROS, loss of glucose-stimulated insulin secretion, and increased apoptosis. These outcomes on beta cell function resemble cytokine treatment. PMID: 28232183
  18. Nox1-knockout (Nox1-KO) mice did not exhibit increased sensitivity to S. Tm colonization and infection compared to WT B6 mice. PMID: 28028364
  19. Data provide direct evidence that NOX1 and NOX2 deficiency impairs macrophage differentiation. PMID: 27489105
  20. In a depressive disorder model, NOX1 is upregulated only in the ventral tegmental area but not in the prefrontal cortex. PMID: 28314819
  21. NOX1 promotes colon mucosal wound repair by sustaining the bioactivity of crypt progenitor cells and plays a critical role in epithelial restitution in cases of colitis-related damage. PMID: 26876598
  22. p38 and NOX1 are essential for the protective effect of c-Myb, with NOX1 acting upstream of p38 activation. PMID: 27107996
  23. The results suggest that radiation-induced pulmonary fibrosis can be effectively reduced by specific inhibition of NOX1, an effect mediated by a reduction in fibrotic changes of ECs. PMID: 27053172
  24. Data demonstrate that the PI3K p110alpha-Akt/Rac1 and NOX1 signaling pathways play a critical role in VEGF-induced vascular differentiation and cell migration. PMID: 26553657
  25. Data show that caveolin 1 (CAV1) is required for transforming growth factor-beta (TGF-beta)-induced reactive oxygen species production, mediated by NADPH oxidase NOX1, which is necessary for a disintegrin and metalloproteinase 17 (ADAM17) activation. PMID: 26815118
  26. Results indicate that NADPH oxidase 1 modulates the innate and adaptive cellular immune response to influenza virus infection, while also playing a role in host survival. PMID: 26910342
  27. JNK suppresses the inflammatory response to TNF-alpha by reducing Nox1-dependent endosomal reactive oxygen species production. PMID: 26001727
  28. BMP4 has a role in inducing NOX1-dependent eNOS uncoupling in T2DM, which may promote the development of novel therapeutics restoring endothelial function in T2DM. PMID: 26121233
  29. NOX1 and NOX4 signaling mediates the pathogenesis of liver fibrosis, including the direct activation of HSC. PMID: 26222337
  30. Nox1 may have a protective effect against hypoxia-induced sinoatrial node dysfunction. PMID: 25837936
  31. NOX1-mediated chemoresistance is associated with the reactive oxygen species/HIF-1alpha/MDR1 pathway. PMID: 26545779
  32. These findings support the central role played by NOX-ROS in the pathogenic cascade leading to muscular dystrophy and suggest diapocynin as an effective NOX inhibitor that could be beneficial for future therapeutic approaches. PMID: 25329652
  33. Novel molecular mechanisms underlying oxidative stress-mediated dopaminergic neuronal death have been established, where MMP3 activation is a key upstream event leading to Nox1 induction and eventual dopaminergic neuronal death. PMID: 25536219
  34. Early, but not late, postnatal hyperoxia results in the induction of NOX1 expression, which is dependent on mitochondrial reactive oxygen species. PMID: 26092998
  35. Local activity of NADPH oxidase differentially modulates responses to ET-1 with aging in distinct vascular beds. PMID: 24382462
  36. Data suggest that these key interactions could be valuable for discovering and screening apocynin analogues as potent inhibitors of NADPH oxidase. PMID: 23344042
  37. Weakly positive reactions with Nox1, Noxa1, and Noxo1 were observed in the zones of proliferative and prehypertrophic chondrocytes at 3 weeks of age. PMID: 25152242
  38. NOX induces macrophage autophagy by producing reactive oxygen species during Aspergillus fumigatus infection. PMID: 25652860
  39. Data reveal that both Nox1 and Nox2 were involved in collagen-mediated thrombus formation at arterial shear and indicate a major role for Nox1 in GPVI-dependent ROS production, which regulates TxA2 generation via a p38-dependent signaling pathway. PMID: 24494191
  40. Nox1 threonine 429 phosphorylation facilitated the association of Nox1 with NoxA1 activation domain. PMID: 25228390
  41. Schistosoma japonicum infection causes upregulation of cannabinoid receptor-1 and NADPH oxidase, leading to fibrotic activation of mouse hepatic stellate cells. PMID: 24657416
  42. Our findings suggest that strategies targeting NOX1 have the potential to be effective treatments for a range of ischemic retinopathies. PMID: 24053718
  43. We identify a critical role for Nox1 in late ischemic preconditioning and define a previously unrecognized link between TNF-alpha and NF-kappaB in mediating tolerance to myocardial injury. PMID: 24501329
  44. These data identify the two specific sites of N-linked glycosylation of murine NOX1 and demonstrate that they are not required for normal enzyme activity, protein stability, and membrane trafficking. PMID: 24361341
  45. We propose that ileocolitis in GPx1/2-double-knockout mice is caused by Nox1, which is induced by TNF. PMID: 24374371
  46. NOX1 is involved in acute respiratory distress syndrome pathophysiology and is responsible for the damage occurring in alveolar epithelial cells, at least partly via STAT3 signaling pathways. PMID: 24551274
  47. Data indicate that urotensin II (UII) increased reactive oxygen species production by NADPH oxidase. PMID: 24116164
  48. gp91(phox-/-) mice appear to be completely protected from dopaminergic cell loss. PMID: 24379900
  49. Following 30 minutes of ischemia and 24 hours of reperfusion, a significant decrease in the size of myocardial infarct was observed in Nox1-, Nox2- and Nox1/Nox2-, but not in Nox4-deficient mice. PMID: 24051369
  50. Data show that gp91(phox)-containing NADPH oxidase activity in macrophages and neutrophils was essential for optimal bacterial clearance during respiratory Methicillin-resistant Staphylococcus aureus (MRSA) infections. PMID: 24563256

Show More

Hide All

Database Links
Subcellular Location
Cell projection, invadopodium membrane; Multi-pass membrane protein. Cell membrane.
Tissue Specificity
[Isoform 2]: Expressed in colon and vascular smooth muscle cells (VSMC).

Q&A

What is the basic structure and function of NOX1?

NOX1 is a member of the NADPH oxidase family that generates superoxide (O₂- −) by transferring electrons from NADPH to molecular oxygen. The functional NOX1 complex includes several subunits: NOX1 (the catalytic subunit), p22phox, NOXO1 (NADPH oxidase organizer 1, a homologue of p47phox), NOXA1 (NADPH oxidase activator 1, a homologue of p67phox), and small GTPase RAC1 . The mouse NOX1 protein consists of 591 amino acids with multiple transmembrane domains and cytosolic components that facilitate electron transfer . Its primary function is the regulated production of superoxide, which acts as a signaling molecule in various cellular processes including cell growth, differentiation, and migration .

How does mouse NOX1 differ from human NOX1?

While mouse and human NOX1 share significant sequence homology and functional similarities, there are important differences in expression patterns, regulation mechanisms, and downstream effectors. Mouse NOX1 (Uniprot: Q8CIZ9) exhibits tissue-specific expression patterns that don't perfectly align with human NOX1 distribution . These differences must be considered when translating findings from mouse models to human applications. Additionally, specific antibodies against mouse NOX1 may not cross-react with human NOX1, necessitating species-specific reagents for accurate detection and characterization .

What are the known isoforms of mouse NOX1 and their functional differences?

Mouse NOX1 exists in multiple isoforms, including a full-length version and shorter variants with distinct functional properties. The full-length NOX1 (NOH-1L) contains the complete electron transport chain necessary for superoxide production, while shorter variants like NOH-1S may function primarily as proton channels without the electron transport capabilities . These isoforms arise from alternative splicing and can exhibit different subcellular localizations, activation mechanisms, and biological functions, complicating experimental design and data interpretation in NOX1 research .

What are the validated methods for detecting mouse NOX1 protein expression?

Multiple validated methods exist for detecting mouse NOX1 protein expression, each with specific advantages and limitations. Western blot analysis using specific monoclonal antibodies can reliably detect NOX1 protein in tissue and cell lysates . Immunohistochemistry (IHC) allows visualization of NOX1 expression in formalin-fixed, paraffin-embedded tissues, enabling assessment of expression patterns in different cell types within complex tissues . Confocal microscopy provides high-resolution imaging of NOX1 subcellular localization, while flow cytometry allows quantification of NOX1 expression at the single-cell level . For optimal results, researchers should use antibodies validated in both overexpression and knockout systems to ensure specificity .

How can I accurately measure NOX1 enzymatic activity in mouse tissue samples?

Measuring NOX1 enzymatic activity requires assessing superoxide (O₂- −) production, which can be accomplished through several complementary approaches. Lucigenin-enhanced chemiluminescence provides a sensitive method for quantifying superoxide production in cell and tissue homogenates. Alternative approaches include cytochrome c reduction assays, dihydroethidium (DHE) oxidation, and Amplex Red assays for H₂O₂ detection (following SOD-mediated dismutation of superoxide) . For precise attribution of ROS production to NOX1 specifically, researchers should incorporate appropriate controls including NOX1 inhibitors, genetic knockdown/knockout models, and SOD to confirm ROS species identity. Correlation of enzyme activity with protein expression levels by Western blot or other protein detection methods provides additional validation .

How does the tissue distribution of NOX1 expression in mice compare to other NOX family members?

NOX1 expression in mice shows distinct tissue distribution patterns compared to other NOX family members. NOX1 is predominantly expressed in colon epithelium, with lower expression levels in other tissues . In contrast, NOX2 is primarily expressed in phagocytic cells, NOX3 in the inner ear, NOX4 in kidney and vascular tissues, and NOX5 (absent in mice) in lymphoid tissues and reproductive organs in humans . This differential expression reflects the specialized functions of each NOX isoform. When studying mouse models, researchers should be aware that NOX1 expression is particularly high in colonic epithelium, making it an excellent model system for studying NOX1 function in this tissue context .

Which signaling cascades regulate mouse NOX1 expression and activity?

Multiple signaling cascades regulate mouse NOX1 expression and activity, creating a complex regulatory network. RTK ligands such as platelet-derived growth factor (PDGF) induce NOX1 expression through downstream kinase activation . The serine protease urokinase plasminogen activator (uPA), peptide hormone angiotensin II (Ang II), and cytokines like bone morphogenic protein 4 (BMP4) and interferon gamma (IFN-γ) also stimulate NOX1 expression . At the level of enzyme activation, phosphorylation of the NOXO1 subunit by protein kinase C (PKC) promotes NOX1 complex assembly and ROS production . Additionally, calcium signaling and small GTPases like RAC1 play crucial roles in regulating NOX1 activity. These diverse regulatory mechanisms allow context-specific control of NOX1 function in different tissues and physiological conditions .

How does NOX1 interact with superoxide dismutases (SODs) in redox signaling?

NOX1 and superoxide dismutases (SODs) function as signaling partners in redox balance, with complex interactions that shape cellular redox states. NOX1 generates superoxide (O₂- −), which SOD1-3 convert to hydrogen peroxide (H₂O₂) . This conversion is crucial because O₂- − and H₂O₂ target different cellular components and activate distinct signaling pathways. While O₂- − preferentially inactivates iron-sulfur cluster-containing enzymes, H₂O₂ typically oxidizes protein thiols, particularly in phosphatases . The balanced activity of NOX1 and SODs determines whether O₂- − or H₂O₂ predominates, thereby directing downstream redox signaling outcomes. In cancer cells, this NOX1-SOD interaction can support aerobic glycolysis by modifying glucose metabolism through redox-sensitive pathways . Understanding this interplay is essential for interpreting experiments involving oxidative stress and redox signaling in mouse models .

What are the known protein-protein interactions of mouse NOX1 that affect its function?

Mouse NOX1 engages in multiple protein-protein interactions that regulate its localization, assembly, and enzymatic activity. The p22phox subunit forms a stable heterodimer with NOX1, which is essential for proper membrane targeting and stabilization of the enzyme complex . NOXO1 interacts with NOX1 and membrane phospholipids through its PX domain, facilitating both activation and localization of the enzyme . NOXA1's proline-rich region interacts with SH3 domain-containing proteins like TKS4 and TKS5, enhancing NOXA1-NOX1 binding and promoting localization to specific subcellular structures such as invadopodia . RAC1 GTPase binds to and activates the NOX1 complex in a GTP-dependent manner. Additionally, NOX1 interacts with cytoskeletal components, affecting cell migration and invasion processes . Researchers studying NOX1 should consider these interactions when designing experiments, particularly when using truncated constructs or fusion proteins that might disrupt these important regulatory interactions .

How is NOX1 involved in colorectal cancer development and progression?

NOX1 plays a multifaceted role in colorectal cancer (CRC) development and progression through several mechanisms. In early stages of colorectal carcinogenesis, NOX1 is significantly upregulated, particularly in adenomatous polyps and early adenocarcinomas compared to adjacent normal mucosa . This overexpression contributes to increased ROS production, which promotes DNA damage, genomic instability, and cellular transformation . NOX1-derived ROS also activate signaling pathways that enhance cell proliferation, migration, and survival, including MAPK cascades and PKC signaling . Interestingly, NOX1 expression correlates with RAS mutational status in human colon cancer specimens, suggesting a relationship between oncogenic RAS signaling and NOX1-mediated ROS production . The comprehensive tissue microarray analysis of over 1,200 human tissue cores confirms NOX1 overexpression specifically in colon and small intestinal adenocarcinomas, establishing NOX1 as a clinically relevant therapeutic target in these cancers .

What experimental models are available to study NOX1 function in cancer research?

Researchers have access to several experimental models for studying NOX1 function in cancer research, each with distinct advantages. Cell line models include panels of human colorectal cancer cell lines with varying NOX1 expression levels, which allow correlation studies between NOX1 expression, ROS production, and malignant phenotypes . Stable NOX1 overexpression systems and CRISPR/Cas9-mediated NOX1 knockout cell lines provide controlled settings to investigate gain-of-function and loss-of-function effects . For in vivo studies, xenograft models using NOX1-manipulated cancer cells help assess the impact on tumor growth and metastasis. Additionally, genetically engineered mouse models with intestinal-specific NOX1 alterations, often in combination with established colorectal cancer mutations (APC, KRAS), enable studies of NOX1's role in tumor initiation and progression in a physiologically relevant context . These complementary models allow researchers to comprehensively investigate NOX1's functions across different stages of carcinogenesis .

How do NOX1-derived ROS influence cancer cell migration and invasion?

NOX1-derived ROS profoundly influence cancer cell migration and invasion through multiple mechanisms affecting cytoskeletal dynamics and cell-matrix interactions. NOX1-generated H₂O₂ can inactivate low-molecular-weight phosphotyrosine phosphatase (LMW-PTP), leading to increased p190RHO-GAP production and subsequent inactivation of the RHO-ROCK-LIMK pathway . This alteration disrupts actin stress fibers and focal adhesions, facilitating cancer cell detachment and migration . Additionally, NOX1-stimulated local cancer cell migration along collagen I fibers depends on an oxidative burst caused by arachidonic acid-activated 12-lipoxygenase (12-LOX), resulting in PKC phosphorylation and enhanced NOX1 assembly . This positive feedback loop sustains ROS production necessary for directional migration. Furthermore, NOX1-derived ROS can activate matrix metalloproteinases, degrading extracellular matrix components and creating paths for invading cancer cells . Understanding these mechanisms provides potential targets for therapeutic intervention to inhibit cancer metastasis .

What controls should be included when validating NOX1-specific antibodies?

Rigorous validation of NOX1-specific antibodies requires comprehensive controls to ensure specificity and reliability. Essential positive controls include cell lines or tissues with confirmed high NOX1 expression (such as colon cancer cell lines) and recombinant NOX1 protein as a standard . Negative controls should incorporate NOX1 knockout or knockdown systems, ideally generated through CRISPR/Cas9 or siRNA technologies . Cross-reactivity testing against other NOX family members (NOX2-5) is crucial due to their structural similarities to NOX1 . Additionally, peptide competition assays, where the antibody is pre-incubated with the immunizing peptide, help confirm binding specificity. For monoclonal antibodies, epitope mapping clarifies which region of NOX1 is recognized. Finally, validation across multiple applications (Western blot, IHC, flow cytometry) using the same samples confirms consistent performance across different experimental contexts . This thorough validation approach ensures reliable detection of NOX1 in research applications .

How can I design experiments to distinguish between NOX1-derived ROS and other sources of cellular oxidants?

Designing experiments to distinguish NOX1-derived ROS from other cellular oxidants requires a multi-faceted approach combining genetic, pharmacological, and analytical techniques. Genetically, comparing NOX1 knockout/knockdown cells with controls provides the most definitive evidence of NOX1-specific ROS production . Pharmacologically, using NOX1-selective inhibitors alongside broader spectrum ROS scavengers helps attribute observed effects to NOX1 specifically . When employing ROS detection methods, researchers should use multiple complementary techniques with different specificities: lucigenin-enhanced chemiluminescence or DHE for superoxide detection, and Amplex Red for hydrogen peroxide measurement . Subcellular fractionation before ROS assays can help localize the source of oxidants. To rule out mitochondrial ROS contribution, mitochondria-targeted antioxidants or respiratory chain inhibitors should be included as controls. Finally, time-course experiments can help distinguish between primary (direct NOX1 products) and secondary ROS (generated as downstream consequences), providing insight into the oxidant cascade initiated by NOX1 activity .

What are the key considerations when expressing recombinant mouse NOX1 in experimental systems?

Expressing recombinant mouse NOX1 in experimental systems requires careful consideration of several factors to ensure proper function and physiological relevance. First, since NOX1 functions as part of a multi-protein complex, co-expression of essential partners (p22phox, NOXO1, NOXA1, RAC1) is often necessary for proper assembly and activity . Researchers must choose an appropriate expression system—mammalian cells generally provide the most physiologically relevant post-translational modifications and cellular environment for NOX1 function . When designing expression constructs, attention to proper membrane targeting sequences is essential as NOX1 is a transmembrane protein . Tag selection and placement require careful planning to avoid interfering with protein-protein interactions or enzymatic activity; C-terminal tags are often preferable to N-terminal ones for NOX1 . Expression levels must be carefully controlled, as excessive NOX1 overexpression can lead to toxicity from ROS overproduction or formation of non-physiological complexes . Finally, storage conditions for purified recombinant NOX1 should maintain protein stability, typically requiring glycerol-containing buffers and storage at -20°C or -80°C to prevent freeze-thaw damage .

How can I resolve discrepancies between NOX1 mRNA levels and protein expression?

Resolving discrepancies between NOX1 mRNA and protein expression requires systematic investigation of several potential mechanisms. Post-transcriptional regulation through microRNAs or RNA-binding proteins may selectively target NOX1 mRNA, affecting its stability or translation efficiency . Post-translational modifications can influence NOX1 protein stability and half-life, creating situations where protein levels don't directly correlate with mRNA abundance . Technical factors may also contribute to apparent discrepancies: different detection sensitivities between RT-PCR (for mRNA) and Western blot or IHC (for protein) can create artificial disparities . To address these issues, researchers should employ multiple detection methods for both mRNA (RT-PCR, RNA-seq, in situ hybridization) and protein (Western blot, IHC, mass spectrometry), preferably with quantitative approaches . Pulse-chase experiments can reveal protein turnover rates, while assessing polysome association of NOX1 mRNA provides insights into translation efficiency. As observed in colorectal cancer studies, RAS mutational status may influence NOX1 expression differently at mRNA versus protein levels, highlighting the importance of examining regulatory pathways in specific cellular contexts .

What are common pitfalls when measuring NOX1 activity in complex tissue samples?

Measuring NOX1 activity in complex tissue samples presents several challenges that researchers must address for reliable results. Non-specific ROS detection is a primary concern, as tissues contain multiple ROS sources including mitochondria, other NOX isoforms, xanthine oxidase, and uncoupled nitric oxide synthase . Sample preparation artifacts can introduce oxidative stress that doesn't reflect in vivo conditions. Tissue heterogeneity means that high NOX1 activity in specific cell populations may be diluted when analyzing whole tissue homogenates . To overcome these challenges, researchers should use cell-type specific markers in conjunction with NOX1 detection when performing immunohistochemistry or flow cytometry on disaggregated tissues . Pharmacological inhibitors with different specificities help distinguish NOX1 activity from other sources. Fresh tissue preparation with appropriate buffers containing antioxidants minimizes artifactual ROS generation. Normalization to NOX1 protein levels rather than total protein improves accuracy in comparing samples with variable NOX1 expression . Finally, validation in genetic models (NOX1 knockout or knockdown) provides the strongest evidence for NOX1-specific activity .

How should contradictory findings on NOX1 expression across different cancer types be interpreted?

Interpreting contradictory findings on NOX1 expression across cancer types requires careful consideration of methodological differences, cancer heterogeneity, and context-specific regulation. The comprehensive study using validated monoclonal antibodies found that NOX1 is consistently overexpressed in colorectal and small intestinal cancers but, contrary to some previous reports, not in prostate, lung, ovarian, or breast carcinomas . These discrepancies may arise from antibody specificity issues in earlier studies, highlighting the critical importance of thorough antibody validation . Cancer subtype heterogeneity may also contribute, as specific molecular subtypes within a cancer type might show differential NOX1 expression patterns . Stage-specific expression is another consideration—NOX1 may play a crucial role primarily in early carcinogenesis and be downregulated in advanced stages of certain cancers . Different detection methods (IHC vs. Western blot vs. RNA analysis) can yield varying results due to different sensitivities or assessment of different molecular species . Researchers should therefore interpret NOX1 expression data in the context of the specific methodology used, cancer stage and subtype examined, and with careful attention to the validation status of detection reagents .

What are the most promising therapeutic approaches targeting NOX1 in colorectal cancer?

Several therapeutic approaches targeting NOX1 in colorectal cancer show significant promise for clinical development. Small molecule NOX1 inhibitors with high specificity over other NOX isoforms are being developed, with some showing efficacy in preclinical colorectal cancer models . Antibody-based approaches, facilitated by the development of highly specific NOX1 antibodies, may enable targeted delivery of cytotoxic agents to NOX1-overexpressing tumor cells . RNA interference strategies using siRNA or antisense oligonucleotides against NOX1 have demonstrated anti-tumor effects in experimental models . Additionally, combination therapies targeting both NOX1 and its downstream effectors or complementary pathways might provide synergistic benefits while reducing the potential for resistance development . The selective overexpression of NOX1 in colorectal and small intestinal cancers compared to normal tissues provides a favorable therapeutic window for these approaches . Future clinical development will need to address tissue-specific delivery methods, biomarker strategies for patient selection, and potential resistance mechanisms to maximize therapeutic efficacy .

How might single-cell analysis technologies advance our understanding of NOX1 function?

Single-cell analysis technologies offer transformative potential for understanding NOX1 function in complex biological systems. Single-cell RNA sequencing can reveal NOX1 expression heterogeneity within tumors, identifying specific cell populations or states with differential NOX1 expression that may be missed in bulk tissue analyses . Mass cytometry (CyTOF) combining NOX1 protein detection with markers for cell type, proliferation, and signaling pathway activation can map NOX1's relationship to cellular phenotypes at unprecedented resolution . Single-cell proteomics approaches may identify cell-specific NOX1 interactome networks and post-translational modifications. Live-cell imaging of NOX1 activity using genetically encoded ROS sensors enables real-time visualization of NOX1-derived ROS in individual cells, revealing spatiotemporal dynamics of redox signaling . Spatial transcriptomics and proteomics maintaining tissue context will help understand how NOX1 expression relates to tumor microenvironment factors and intercellular communication . Together, these technologies promise to reveal how NOX1 functions within the heterogeneous cellular ecosystems of normal tissues and tumors, potentially identifying new therapeutic opportunities .

What role might NOX1 play in the tumor microenvironment and cancer immunology?

NOX1's potential role in the tumor microenvironment and cancer immunology represents an exciting frontier for investigation. NOX1-derived ROS may influence tumor-associated macrophages, shifting their polarization toward pro-tumorigenic M2 phenotypes that promote cancer progression . In the extracellular space, NOX1-generated ROS can modify extracellular matrix components, affecting stiffness and composition, which in turn influences cancer cell invasion and metastasis . NOX1 activity might create localized immunosuppressive environments by inducing T-cell exhaustion or apoptosis through oxidative stress . Additionally, NOX1-derived ROS could modulate cytokine and chemokine profiles in the tumor microenvironment, affecting immune cell recruitment and function . Cancer-associated fibroblasts may also be influenced by NOX1 activity, potentially enhancing their pro-tumorigenic functions . These complex interactions between NOX1, cancer cells, stromal components, and immune cells likely vary across cancer types and stages, with particular significance in colorectal cancer where NOX1 expression is consistently elevated . Future research using co-culture systems, organoids, and sophisticated in vivo models will be essential to unravel these relationships and their therapeutic implications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.